KEGG   Alteromonas macleodii English Channel 673: AMEC673_12415Help
Entry
AMEC673_12415     CDS       T02254                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:amg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2893501..2894805
Genome map
AA seq 434 aa AA seqDB search
MITWSSLSVNEKKQALARPAMANSQQLKQTVGDIIARVEKEGDEAVLDYTRKFDCPDLTS
LVLSQENIDALAAKVTPEVASAIDTAFNNIKMFHEAQMPSDIALTTTPGVKCELRFTALD
AVGLYIPGGSAPLPSTVLMLGVPALVAGCENKLLCTPPNKEQLIAPEIAYAARKCGIDKI
FLCGGAQAIAAMALGTDSVPQVDKIFGPGNSFVTEAKQQVSQRADGAAIDMPAGPSEVLV
LADEFANPEFVAADLLSQAEHGPDSQAILVSNSATLIEEAKAAVERQLATLSRAEIARPA
MENARYILADSIEQAIEASNAYAAEHLIVQIENARDYLPKIKYAGSIFLGPWSPESAGDY
ASGTNHVLPTYGYAKNYSSLGLLDFMRRYTIQELSADGMRNLGPAIMALAAAEGLDAHEQ
AVALRMQALKQGDA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgattacttggtcatctctttcggtaaatgagaaaaaacaggcgctagcccgcccggct
atggccaatagccaacagttaaagcagaccgtgggcgacattatcgcccgcgttgaaaaa
gaaggcgatgaggcagtacttgattacacacgtaaatttgactgcccagacttaactagc
cttgtactttcacaagaaaacattgatgctcttgctgcgaaggtaacgccagaggtagca
agtgctatcgatactgcgttcaacaacataaaaatgtttcacgaagcgcaaatgcctagt
gatatcgcgctaaccacaacgcctggtgttaaatgcgagctgcgcttcaccgcccttgat
gcagtgggtctttatattccaggcggcagcgcgccgcttccttctaccgtattgatgcta
ggcgtacctgcattggtggcgggctgcgaaaataagctactttgtactccaccaaacaaa
gaacagcttatcgcgcctgaaattgcgtatgcggccagaaaatgcggcatcgacaagatc
ttcttgtgtggtggtgcccaagcaatcgccgctatggccttgggaacagacagcgttcct
caagtagataagatttttggcccgggtaacagctttgtgactgaagctaaacagcaagta
agccaacgtgctgatggtgcagctattgatatgccggccggcccatcagaagtgttggta
cttgctgatgagttcgcaaaccctgagtttgtagcggccgacctgctttcccaagccgag
cacggtccagactcgcaggctattttggtgtctaacagcgctacacttattgaagaagca
aaagccgcggttgaacgtcaattagcaaccctatctcgcgctgagattgcccgccctgct
atggaaaatgcgcgttatattttggctgattccattgagcaagccattgaagcaagtaac
gcctacgctgctgagcacttaattgtacaaatagagaatgcccgtgattatttgccaaaa
attaaatacgcaggctctatattcctaggcccgtggtcaccagaatctgcaggtgattac
gcgtcgggcactaaccacgtcctgccaacctatggctatgctaagaattactctagcctt
ggattattagactttatgcgtcgctacactattcaagaactaagcgcagacggcatgcgt
aatttaggccctgcgattatggcacttgcagctgccgagggcttggatgcacacgaacag
gccgttgcacttcgcatgcaggcacttaagcaaggagacgcctaa

DBGET integrated database retrieval system