KEGG   Alteromonas macleodii English Channel 673: AMEC673_13075Help
Entry
AMEC673_13075     CDS       T02254                                 

Definition
(GenBank) Outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00564  Glycerophospholipid metabolism
amg00565  Ether lipid metabolism
amg00590  Arachidonic acid metabolism
amg00592  alpha-Linolenic acid metabolism
amg01100  Metabolic pathways
amg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMEC673_13075
   00565 Ether lipid metabolism
    AMEC673_13075
   00590 Arachidonic acid metabolism
    AMEC673_13075
   00591 Linoleic acid metabolism
    AMEC673_13075
   00592 alpha-Linolenic acid metabolism
    AMEC673_13075
Enzymes [BR:amg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     AMEC673_13075
    3.1.1.32  phospholipase A1
     AMEC673_13075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFT75301
UniProt: A0A0E0YDZ1
Position
3051250..3052266
Genome map
AA seq 338 aa AA seqDB search
MSLLKPFVFLAAFAACTPVCAQQSQEVVSEQASSSENSEQERTIENEENQSSQDESGIEV
IDIIKRDTITESALDNRLEGDKEALDNVFAITQHRQNYLLPITYVSNPSSVASEELTNEN
IDNKEAKFQVSAKLPLYLEDTGFDGVYFGFTLTSFWQLYNSEASKPFRETNYEPEVFWQE
TADYSVLGYKFNTFQVGFNHMSNGQSGLRSRSWNRIFASIVFSDDDDIYYLKTWYRIPED
EKTDPLDPTGDDNPDIQDYYGRMELGYGRKIGAFKVLALLRNNLDVDENRGSIQLDFTYP
ISDRYEVLLQYFNGYGDSLIDYNRSQERIGIGFQLHFL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgtctttgttaaagccttttgtatttttggcagcatttgctgcttgcacgcctgtttgc
gctcaacaatcacaagaagtggtaagcgaacaagcgtcatcttcagaaaatagtgaacaa
gagcgcactattgaaaatgaagaaaatcaatcgtcacaggatgaaagcggtattgaagtt
atcgatatcatcaagcgtgacaccatcacggaaagtgcactggataaccgattagaaggc
gataaagaagcactggataatgtgtttgctatcactcagcatagacaaaactatctactt
ccaattacttacgtttccaacccaagctctgtggcaagtgaagaactcacaaacgagaac
atagacaataaagaagcaaaatttcaggtaagcgcaaagctgccgctttatttggaagat
acaggattcgacggtgtttactttggctttacgctaacctctttctggcagctttataac
agcgaagcgtcgaagccgtttcgcgagaccaattacgaaccagaagtcttttggcaagaa
acagccgattattccgtgcttggctacaaatttaatacttttcaagttggtttcaatcat
atgtctaacggtcaaagcgggctgcgctctcgaagctggaaccgtatatttgcctctatt
gtctttagcgacgatgacgatatctactacctaaagacgtggtaccgtattcctgaagac
gagaaaacagacccgcttgatcctaccggcgacgataaccctgatatacaagactattac
ggtagaatggaacttggttatggaaggaaaattggcgcgtttaaagtactggcgctttta
cgaaataacctcgacgtagatgagaaccgaggcagcatccagctagacttcacctaccct
atctctgaccgctatgaagtcttgcttcaatacttcaatggctatggcgattcgcttatc
gactataaccgctcacaagaacgtattggtatcggttttcagctgcactttttgtaa

DBGET integrated database retrieval system