KEGG   Alteromonas macleodii English Channel 673: AMEC673_13355Help
Entry
AMEC673_13355     CDS       T02254                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMEC673_13355
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMEC673_13355
Enzymes [BR:amg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AMEC673_13355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3112350..3113945
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGVEDLTE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDG
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acttgggaaggtatcaacccagaattcgctgcacgcatgaaggttcaaaaccgttttaaa
acaggtttagacattgctcgctacactgcaagcattatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggcttcgtaggccaa
caaaaaatgctttcagttaaaaagcatcaaggcacaactaacaaaagctacctttacctt
tcaggctggatggtagcagcacttcgctctgaatttggtcctcttcctgaccaatcaatg
catgaaaaaacatcagtgtctgcgcttatcgaagaactttatactttccttcgccaagca
gatgcgcgtgaattgggcgaccttttccacaagctagacgacgctaagaaaaacggtggt
gatgttgctgcgattcaagctgaaatcgacaattacgaaactcacgtagttccaattatc
gcagatatcgatgcgggctttggtaacgaagaagcaacctacctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaattgagaaccaagtatcggacgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcgaaaatcaatgca
gtacgctatgcattccttgaactaggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtcttacccagaagatcccagtatctacatcagaaggcgacttagct
gctcagtacaatgctttccttaaaaccaccgaagttgcgggtgttgaagacctaactgaa
ggtgatctggtgcttaaacaaggtggcaagctggttaaacctgagcgcctaccaaacggc
ttgttccgctttaaagacaacacaggttttgaccgtgtagtacttgactgcgtaacgtca
cttaagcacggcgctgacttgctttggattgaaactgaaaagcctcacgttggccaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaacgcaaagctggtttataacaac
tctccatcattcaactggacgcttaatttccgtcagcaagtgtttgatgcttggacagaa
gaaggcaaagacgtatctggctacgaccgcgcgaaacttatgtctgctgactatgatggc
agcgaacttgcagcagcagcggacgagaagattaagagcttccaggctgacgcagcacgc
gaagcgggtatcttccaccaccttatcacgctaccgacttaccacactgcagcgctgtct
actgacaaccttgcaaaaggttacttcggtgaagaaggtatgcttgcttatgttcgcggt
gttcagcgtcaagaaattcgccaaggtctagcgtgtgttaagcaccaagcgatggcaggt
tctgacctaggtgatacacacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaaccagtttgacgtataa

DBGET integrated database retrieval system