KEGG   Alteromonas macleodii English Channel 673: AMEC673_13355Help
Entry
AMEC673_13355     CDS       T02254                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMEC673_13355
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMEC673_13355
Enzymes [BR:amg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AMEC673_13355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3112350..3113945
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQNGTWEGINPEFAARMKVQNRFKTGLDIARYTASIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTNKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDEGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGVEDLTE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDG
SELAAAADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccacattaaaggcagcacaaaacgga
acttgggaaggtatcaacccagaattcgctgcacgcatgaaggttcaaaaccgttttaaa
acaggtttagacattgctcgctacactgcaagcattatgcgcaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggcttcgtaggccaa
caaaaaatgctttcagttaaaaagcatcaaggcacaactaacaaaagctacctttacctt
tcaggctggatggtagcagcacttcgctctgaatttggtcctcttcctgaccaatcaatg
catgaaaaaacatcagtgtctgcgcttatcgaagaactttatactttccttcgccaagca
gatgcgcgtgaattgggcgaccttttccacaagctagacgacgctaagaaaaacggtggt
gatgttgctgcgattcaagctgaaatcgacaattacgaaactcacgtagttccaattatc
gcagatatcgatgcgggctttggtaacgaagaagcaacctacctacttgcaaagcaaatg
attgaagcaggtgcatgctgtatccaaattgagaaccaagtatcggacgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctagcgaaaatcaatgca
gtacgctatgcattccttgaactaggtgttgatgaaggtgtaattgttgcacgtactgac
tcactaggtgctggtcttacccagaagatcccagtatctacatcagaaggcgacttagct
gctcagtacaatgctttccttaaaaccaccgaagttgcgggtgttgaagacctaactgaa
ggtgatctggtgcttaaacaaggtggcaagctggttaaacctgagcgcctaccaaacggc
ttgttccgctttaaagacaacacaggttttgaccgtgtagtacttgactgcgtaacgtca
cttaagcacggcgctgacttgctttggattgaaactgaaaagcctcacgttggccaaatt
gctgaaatggttaacgctattcgcgaacaagtaccaaacgcaaagctggtttataacaac
tctccatcattcaactggacgcttaatttccgtcagcaagtgtttgatgcttggacagaa
gaaggcaaagacgtatctggctacgaccgcgcgaaacttatgtctgctgactatgatggc
agcgaacttgcagcagcagcggacgagaagattaagagcttccaggctgacgcagcacgc
gaagcgggtatcttccaccaccttatcacgctaccgacttaccacactgcagcgctgtct
actgacaaccttgcaaaaggttacttcggtgaagaaggtatgcttgcttatgttcgcggt
gttcagcgtcaagaaattcgccaaggtctagcgtgtgttaagcaccaagcgatggcaggt
tctgacctaggtgatacacacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaaccagtttgacgtataa

DBGET integrated database retrieval system