KEGG   Alteromonas macleodii English Channel 673: AMEC673_13365Help
Entry
AMEC673_13365     CDS       T02254                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMEC673_13365
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMEC673_13365
   00630 Glyoxylate and dicarboxylate metabolism
    AMEC673_13365
Enzymes [BR:amg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMEC673_13365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3115271..3117466
Genome map
AA seq 731 aa AA seqDB search
MQGYITRGRLQVAEQLDNFINEQALPGTGVDKDTFWQGAETLFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVNGNEYTDFLKSIGYLVEQPSQVSAQTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNEGGAEAGKSYNPVRGAKVVAKAKDYLDSMIPL
AKGSHADVTEYKIESGKLAITLADGDETTLANTEQWQGYQGDISAPSSLLFAHNGLHFEI
QLDPTHPIGESDAANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMTKGGKQLVRAMHDDRSYQPSKHASQDKLKDGELVLSGRSLMFVRNVGHLMTNNAMLFD
GEEVPEGIMDGLVTSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
AIIDVPANTLKMGIMDEERRTSINLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAGPF
AEKAALKSMAWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMTAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDENFSGLADILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMAPDLNSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAAS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattactagaggccgactacaggttgccgaacaactcgataactttatt
aatgaacaggcacttcctggcacaggcgtagataaagacaccttttggcaaggtgcagaa
accctcttcgaaaaattcattcctcaaaatcgcgcactattagaaaagcgagaacagctt
cagcgcgctatcgacgattatcataaagctggtaacccggtaaacggaaacgaatatacc
gacttcctaaaaagcattggttaccttgttgagcagccgtcacaagtaagtgcacaaaca
caaaatgtagacgccgaaatagcaacaatggcaggccctcagctagtcgtgccaatcaac
aacgctcgctatgcacttaacgcggtaaatgcccgttggggtagcctttacgacgcacta
tacggcactgatgtcatcagcaatgaaggtggagcagaagcgggaaaaagctacaacccc
gtacgcggcgccaaagtagttgcgaaagcgaaagactatctagatagcatgatacccctt
gcgaaaggcagccacgctgacgttactgagtataagattgaatcgggtaaattggcgatc
actcttgccgacggcgatgaaaccaccttagcaaacacagagcaatggcaaggataccaa
ggtgacattagcgcaccgtcaagcctgctatttgcacacaacggtctgcattttgaaatt
caactagacccgactcaccctattggcgagagcgatgccgcaaacgtaaaagacgtactg
gttgaagctgcattaaccaccattatggactgcgaagattccgttgctgctgttgacgct
gaagacaaaaccttggtgtatagcaactggttaggcttaatgaaaggctcgctaagcatt
gaaatgacaaagggcggcaagcagcttgttcgcgctatgcatgacgatagaagctaccag
ccgtctaaacacgcttcacaagacaagctaaaagacggcgaactagtactttctggtcga
agccttatgtttgttagaaacgtgggccaccttatgactaacaatgccatgctctttgac
ggcgaagaagtgccagaggggatcatggacggtttagtcacttcacttatcgcaaagcat
gatcttttaggaaacagcaaatttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcacgggccagaagaagttgcattctctaacgcattgtttggtgctatcgaa
gccattatcgatgttccagctaacacccttaaaatgggcataatggatgaagaacgccgc
acaagtatcaatttacaagcatgtattgccgaggctacttcacgcgttgtgttcattaac
acgggtttcttagacagaaccggtgatgaaattcatacctcaatgcttgccggccctttt
gcagaaaaagccgcgctcaagtctatggcgtggattaaggcttatgaaactgcaaacgtc
gcagtaggccttcgctgcggcctttctggcaaagcgcaaattggtaagggcatgtggcca
atacctgacgaaatgcaaaatatgatgaccgccaaaataggtcaccctaaggccggcgct
aatactgcttgggtaccctcacctactgctgcaacactgcacgcgcttcattatcacgat
gtaaatgtgtttgacgttcaaaagtcgctagatgaaaactttagtggccttgctgacata
cttaccattccattgttagaagatgcctctactttgacgcgtgagagtattaagcgtgaa
atcgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggcgta
ggctgctcgaaagttcctgacattaacaatgtaggcttgatggaagaccgcgcgacgttg
cgaatttcatcgcagcatatcgctaactggctagagcacggcattgtaagtgtagatcag
gtaaaagagtctttggctcgtatggctgtcttagtagatgagcaaaatgcgggggatcct
gagtatatccctatggcacctgatttaaacagctcaattggtttcttagccgcaagcgat
ctaatattcaaaggtaaagagcagcctagcggttacacagaacctttactgcacgcacgt
cgccgcgaaatgaaggcaaaacttgcggcgagctag

DBGET integrated database retrieval system