KEGG   Alteromonas macleodii English Channel 673: AMEC673_14190Help
Entry
AMEC673_14190     CDS       T02254                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AMEC673_14190
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMEC673_14190
Enzymes [BR:amg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AMEC673_14190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3318068..3320620)
Genome map
AA seq 850 aa AA seqDB search
MIRNSTNFVKACLSLSLLLVGSASAMAETPSLQQASLNALGESLDIHYEVLSNVDDSLCR
VHIPKGDCFSSELTIATMATPIEASTSLYFSHIAPIRGYDSKNAIRIEHINGDLHRLTFE
EKVSASEQVKVTLSAPFWHTSRSDAMPNYYLTYPALSPVVVASTTRVKEPGSNLLINQHT
GLWSKQAQYKRTENDNTPLMDSAYLYNKGDSALTSDDAENRVIPNVSRRDDSGKFVAAAG
INIDKSDQDMLAPAIEQMAYFGLTNQKTGLPLKVIIRSAHDADALANEAAKINSKEGYAL
SITEQSATIIANDNISANYGLLTLMQVFDAQHGRFPITEIADSPRFEFRGMHLDIARHFP
GKAAIESVVRQMFTYKLNKLHLHLSDDEGWRLAIDALPELTEIGAFRCHDLSETQCLLPQ
LGSGPFKSATGNGFLTQQDYIEILTMAHARGIEVIPSLDMPGHARAAIVAMNARYKRLMA
EGELDAANEFLLVDKEDKTQYESVQFYSDNTINPCLDSSYHFIETVLTSVKSLHEKANVP
LTHFHVGADETAGAWVKSPVCAAKGQKADEILPAFVTEVQKIAQKHNIAIGGWSDGMEKA
VNTLDNSSAYTNVWHLLAAGGEKTVSHFAKENIPVVLSFPDVLYFDFPYQSNPYEPGYYW
GSRATNTEKVFSFMPEQLPLHAELWTDRMGHSYSSSAEADTSSVIGIQGQLWSEVTVNQD
AVEYMVFPRLLALAERAWYYAPWQQNAKALHEKGGLVNQQASDWQAFELALFNRHALALV
QQGVNVRVPTPAAVINNGKLHIKPVSGLTMEYLTSGNKWETFTAPVEVKGNVTVRARIAG
TQQMSRQVQL
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgcaattcgacgaattttgtcaaagcgtgcttgagcttatcgttactactagtg
ggtagcgcttcggcaatggctgaaacgccttcgctacagcaagccagcttgaatgcgcta
ggagaaagcctcgatatacattacgaagtattaagtaatgtggacgatagtttgtgccgg
gtacatattccaaaaggcgactgcttttcgtcagagcttacgatagcaaccatggcaacc
cccattgaagcctctacgtcgctttactttagtcatattgcgcctattcgcgggtatgac
tcaaaaaatgcaattcgcattgagcatataaacggtgacctgcaccgcctaacgttcgaa
gaaaaggtgagcgcaagtgagcaagttaaggtaacgctatctgcgcccttttggcacacg
tcccgctcggacgcaatgccgaactattacttaacttaccctgctttatcaccggtggtg
gttgcctccacaacccgtgtgaaagagccgggaagtaatttgctaatcaatcaacacact
ggcttatggagcaaacaagcccagtacaaacgtactgaaaacgacaatacaccgcttatg
gacagcgcgtatttatacaataagggcgattcagcgctaacttcagatgatgccgagaat
cgtgttattcccaacgtaagtcgaagagatgattcgggtaaatttgttgctgccgctggc
attaatatagataagtctgatcaagacatgcttgctccagccattgagcaaatggcctat
tttggcctgactaaccagaaaacaggcttaccgcttaaggttattattcgcagcgctcac
gatgcggacgccctagcaaatgaagctgcaaaaataaactcgaaagaaggctacgcgctt
agcataacagagcaaagcgccacgataattgccaacgataacattagtgctaactacggt
ttgctaacgctaatgcaagtatttgatgcgcagcatggccgctttcctataactgaaatc
gcagactcgccacgattcgaatttcgcggaatgcacttagatattgctcgccactttcca
ggaaaggcagcgattgaatctgttgttcgccaaatgttcacctacaagctcaataagcta
caccttcacctaagtgatgacgagggctggagattagctatcgatgctttgcccgagctt
accgaaattggtgcgtttcgatgccacgatttgtctgaaacacagtgcttgctgcctcag
ctgggaagcggaccttttaaaagtgctacaggtaacggctttcttacgcagcaagattac
attgaaattttaacaatggcgcatgcgcgcggcattgaagttattccgtcgcttgatatg
cctggccatgcccgcgcagcgattgttgctatgaatgcgcgctacaagcggcttatggca
gagggtgaattagatgctgcaaatgagtttttattggtagataaagaagataaaacccaa
tatgaaagcgttcaattctattcagataacaccataaacccctgtttagatagcagctat
cattttatcgaaaccgtacttacttctgtgaaatcactgcatgaaaaggccaacgttccg
ttgacgcacttccatgttggcgccgatgaaaccgccggtgcttgggtgaaatcccctgta
tgcgctgcgaaaggtcaaaaggcggatgaaatactgccagcgtttgttaccgaagtgcag
aaaattgcgcaaaagcacaatatagcaattggtggctggagcgatggcatggaaaaagcc
gtaaatacactggataacagcagcgcgtataccaacgtttggcatcttcttgctgcgggt
ggagagaaaacagtatcgcatttcgcgaaggaaaatattccagtagtactttcgtttcca
gacgtgctttatttcgactttccttaccaaagtaatccttatgagcccggttattactgg
ggttcacgggcaaccaataccgaaaaagtattttcgtttatgcccgaacagctgccgctt
catgccgagttatggaccgaccgtatgggccacagttacagcagttctgctgaggccgac
acatcatcagtaatcggtattcaggggcagctatggtcagaggtcaccgtgaatcaagat
gccgtggaatatatggtattccccagactattggctttggctgaacgggcctggtactac
gcaccatggcaacaaaacgcgaaagcacttcatgaaaaaggcggtttagtaaaccagcag
gcaagcgactggcaagcgtttgagttagcgttatttaaccgccatgcactcgcgctagtg
cagcagggagtgaatgtgcgtgtacctacgccagcagcggtaattaacaatggtaagtta
catataaagccagtgtctggtcttacgatggagtatttaacttcaggtaacaagtgggaa
acctttaccgctcctgttgaagtgaaggggaacgtaactgttcgcgccagaattgcggga
acacagcaaatgagtcgacaggtgcagctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system