KEGG   Alteromonas macleodii English Channel 673: AMEC673_14255Help
Entry
AMEC673_14255     CDS       T02254                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMEC673_14255
Enzymes [BR:amg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AMEC673_14255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3338069..3338965
Genome map
AA seq 298 aa AA seqDB search
MAIINFGSINIDHVYQVDHFVQPGETLASTHYQTLLGGKGANQSIALAQAGADVRHVGSI
HENDASFKQALIKKGVDCRGVKCSEVPSGHAIIQVTPSGENAIVLFGGANQTITAKTVMQ
ALDDTRPSDWVLTQNETSSIEEVLRQAKEKQLKVAFNPAPMSESVKQLPLDCVDLLIVNE
TEAAAITGKEELEDIVTVFKEQWSHSEVIITLGKAGVMMLRKNDVVEVKAFSVDAVDTTA
AGDTFIGYFLSAYSNHTDAKQALRRGCAASAIAVTREGAAQSIPTQKEVDRFLAKHAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaataataaattttggctctataaatattgaccacgtttatcaggtagatcacttt
gtacaacctggtgagacgttggcctctacccattatcaaaccttattaggtggtaagggt
gcaaaccagtctattgctttagcgcaagcaggtgcagacgtaagacacgtcggcagcatt
cacgaaaacgacgcctcatttaaacaagctcttattaagaagggtgttgattgtcgtggc
gtaaagtgctcagaagttccttcaggtcacgcgattatccaagtcacgcctagcggtgaa
aacgccattgtattatttggtggtgctaaccaaaccattaccgcaaaaaccgtaatgcaa
gcgttagacgatacgcgtccttcagattgggtactaacccaaaatgaaacaagcagcatt
gaagaagtacttcgccaagcgaaagaaaagcagcttaaagtagcctttaacccagcgcct
atgagcgagtcggttaagcagcttccattagattgtgtagatttacttattgtaaatgaa
accgaagctgctgcgattaccggtaaagaagaacttgaagatattgtgacagtgttcaaa
gagcagtggtcacacagcgaagttattattacactgggtaaagcgggtgtaatgatgctg
cgcaaaaacgatgttgtagaagtaaaagcattctctgtagacgcggtagataccaccgca
gccggtgacacctttatcggttatttcctgtctgcatacagcaaccacaccgatgctaaa
caagcattgcgtcgcgggtgtgcagcttcagcgattgcggtaacccgcgagggcgcagcg
cagagtattccaacacaaaaagaagtggatcgtttcttagcgaaacacgccaactag

DBGET integrated database retrieval system