KEGG   Alteromonas macleodii English Channel 673: AMEC673_14805Help
Entry
AMEC673_14805     CDS       T02254                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMEC673_14805
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMEC673_14805
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMEC673_14805
Enzymes [BR:amg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMEC673_14805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3461715..3462998)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIDELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISSLQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKRDQLV
ISVPSGNFGNLTAGMIAKSLGLPIKRFIAATNLNDTVPRYLKTGEWEPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYDALKQ
HMMDLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcaaattttgctgaagccgttaag
cggggcttaggtaaaaaccaagggctttatttcccagagcatattcctaccctagacaat
attgacgaattgttggaaaagccatttgtagagcgcagtattgaagtacttcgcgccctt
atcggcgatgagctgaataatggcgagctagaagaaattgttcagaccgcatttgctttt
ggtgcaccagttgagcaggtcaacgataacgtatactgcttagagcttttccatggtcca
acgctggcgtttaaagattttggcggccgctttatggcgcaaaccctgtcgcgtattagc
gaagggaagccagttaccattctaacagcgacttcaggtgataccggcgcagcggttgca
catgcatttcacggcatcgacaatatcaacgtggttattttgtttccaaagggcaagatt
agctcgctgcaggaaaagctattcactacgctaggcggtaatattcataccgttgctgtt
gagtcagactttgacgcatgccaatcactagtaaaaaccgcgtttgacgaccctgacgta
cgtgaaggccttcacctgaactcagcaaactcaatcaacatcagccgtttactagcgcag
gtttgctattactttgaagcagtaagtcagttgccaaaagagaaacgagaccaactcgtt
atttcagtacctagtggtaactttggtaaccttacggctggcatgattgctaaatcgtta
ggtttacctataaagcgttttatcgcagcaactaacttaaacgacacggtacctcgatac
cttaaaaccggcgagtgggaacctaaggcgacggttgcgaccatgtctaacgcaatggat
gtgagtcagcctaataactggccgcgaatagaggcgcttattgagcgtggctatatcgac
aaagcgtgtcttaaaggtgagatggttgacgaagaatatacgcagcttgctatgcgtcaa
ttagcgcaacaaggctataccagcgagccacatgccgcgattgcctatcgcgcagtaagt
catgacttagaagacggcgaaattggtttgttcttaggaacagcgcacccggctaagttc
agagaaaccgttgaaaacgtgctaggtaatccaatcagcttaccgaaagcgttggccgat
gtagcaggcgaagacagcttagcggtagacttgccagcgtcttacgatgcacttaagcag
catatgatggatttgcttaagtaa

DBGET integrated database retrieval system