KEGG   Alteromonas macleodii English Channel 673: AMEC673_14805Help
Entry
AMEC673_14805     CDS       T02254                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:amg00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:amg00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3461715..3462998)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIDELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISSLQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKRDQLV
ISVPSGNFGNLTAGMIAKSLGLPIKRFIAATNLNDTVPRYLKTGEWEPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYDALKQ
HMMDLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcaaattttgctgaagccgttaag
cggggcttaggtaaaaaccaagggctttatttcccagagcatattcctaccctagacaat
attgacgaattgttggaaaagccatttgtagagcgcagtattgaagtacttcgcgccctt
atcggcgatgagctgaataatggcgagctagaagaaattgttcagaccgcatttgctttt
ggtgcaccagttgagcaggtcaacgataacgtatactgcttagagcttttccatggtcca
acgctggcgtttaaagattttggcggccgctttatggcgcaaaccctgtcgcgtattagc
gaagggaagccagttaccattctaacagcgacttcaggtgataccggcgcagcggttgca
catgcatttcacggcatcgacaatatcaacgtggttattttgtttccaaagggcaagatt
agctcgctgcaggaaaagctattcactacgctaggcggtaatattcataccgttgctgtt
gagtcagactttgacgcatgccaatcactagtaaaaaccgcgtttgacgaccctgacgta
cgtgaaggccttcacctgaactcagcaaactcaatcaacatcagccgtttactagcgcag
gtttgctattactttgaagcagtaagtcagttgccaaaagagaaacgagaccaactcgtt
atttcagtacctagtggtaactttggtaaccttacggctggcatgattgctaaatcgtta
ggtttacctataaagcgttttatcgcagcaactaacttaaacgacacggtacctcgatac
cttaaaaccggcgagtgggaacctaaggcgacggttgcgaccatgtctaacgcaatggat
gtgagtcagcctaataactggccgcgaatagaggcgcttattgagcgtggctatatcgac
aaagcgtgtcttaaaggtgagatggttgacgaagaatatacgcagcttgctatgcgtcaa
ttagcgcaacaaggctataccagcgagccacatgccgcgattgcctatcgcgcagtaagt
catgacttagaagacggcgaaattggtttgttcttaggaacagcgcacccggctaagttc
agagaaaccgttgaaaacgtgctaggtaatccaatcagcttaccgaaagcgttggccgat
gtagcaggcgaagacagcttagcggtagacttgccagcgtcttacgatgcacttaagcag
catatgatggatttgcttaagtaa

DBGET integrated database retrieval system