KEGG   Alteromonas macleodii English Channel 673: AMEC673_16280Help
Entry
AMEC673_16280     CDS       T02254                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
amg  Alteromonas macleodii English Channel 673
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3813241..3814347)
Genome map
AA seq 368 aa AA seqDB search
MVKLHYATKATLVIGFLFLLASCSTKEDSEFKSQYIAYKALFVDGGRVVDTGNDDVSHSE
GQGYGMLFAVAANDKDTFDALWHWTQRTLMREDGLFSWRYRPCVDNSSSCIDDPNNASDG
EILIAWALLRASEKWGVGKYEEDARNIVRAVEQKLLVVNNNSVVLLPGEYGFASDQTGNS
SLQLNLSYWVFPAITDLSSLSDTPSHWESLFESGLILLSNMQFSTYQLPSDWVRFTPNSA
ESDNSKIGALTLDNVISPEFGFNAIRIPLQLAWSPRFRQNARLTEKLLSPYFAWWAITPT
PATINLLNEETAEYEMSKGMRSVQMAVNSLMKSEEKQRPEWPEINRNMDYYSASLTLLSM
LAVLDNAS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagctgcattacgcaacaaaagcgacgctagtgataggctttttgttcctgttg
gcgtcgtgctctaccaaggaagatagcgaattcaagtctcagtacatagcatataaggca
ttgtttgttgacggcgggcgcgtggtagacacaggaaatgatgatgtgtctcacagcgaa
gggcaaggctacggtatgctctttgccgtcgccgccaacgacaaagacacctttgatgca
ttatggcactggacccaacgtacgctcatgcgagaagacgggctctttagctggcgctac
cgaccttgtgtggataattcatcttcttgtatcgatgaccctaataatgcctctgatggt
gagattcttattgcctgggcattattgcgtgcaagtgaaaagtggggcgttggtaagtat
gaggaggacgccaggaatattgtacgtgctgtagagcagaaacttctggtggtgaataat
aacagtgtagtgctcttgcctggggaatacggatttgcatctgaccaaacaggaaatagc
agccttcagctaaatctgtcctattgggtttttcccgccataactgacctgtcttcgcta
tcggatactccgtcacattgggaaagcctgttcgagtcaggcttgatcttgctgtcgaat
atgcagttttctacctaccaattgcccagtgattgggtgcgtttcacccctaatagtgct
gagtccgataacagtaaaattggtgcgttaactttagataatgtgatatcgcctgagttt
ggttttaatgcgatccgtataccgcttcagcttgcatggtccccacgttttcgccaaaac
gctaggttaactgagaagctactttctccctactttgcatggtgggcgataacgcctacg
ccagctactatcaacctattaaacgaggaaaccgctgagtacgaaatgtctaagggaatg
cgttcagtgcagatggccgtaaacagcttgatgaaatcagaagaaaagcaaaggccagag
tggcctgagatcaatcgaaacatggattattactcggcaagtttaacgctgctttctatg
ctagcagttttggataacgcatcgtga

DBGET integrated database retrieval system