KEGG   Alteromonas macleodii English Channel 673: AMEC673_17010Help
Entry
AMEC673_17010     CDS       T02254                                 

Definition
Phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amg00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:amg00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:amg02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3991780..3993474
Genome map
AA seq 564 aa AA seqDB search
MDRRTFIKLSSFAGASVAVSTGLAGCTVSNSANSQPQTNATFTHGVASGDPLKDAVIIWT
RAVPTEGSGLAKADILWEMASDADFTNVVSSGIVEAKATHDFTVKIDVTGLSPARHYFYR
FKSANNTSPVGETRTLPESDVSNVTFGIFSCSNYPAGFFTPYMEAAKNDNIDYVLHLGDY
IYEYDGKGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALHQNKPFIVV
WDDHEITNDTYKDGAENHQVDEGDFYERRAAAVQAYYEWLPIRPPFGTERLEIYRQFTFG
KLLDLYMLDTRVLARDKQLEYGDYRDAETKAFDQARFMKDIGNPNRGLLGETQRNWLHSS
MQQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKAIPAHVHKLANIKRKQMQGGALSEQEQ
ALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTLKDGTQVGI
ELATPGVTSPGMEHYLSMDDEMAETLADDLPLLIEDLQYCNLHQRGFMTLTVSEDSATAT
WHYVDAILTKVGKVVNTHSYEIKA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaacgtttataaagctgtcgtcattcgcaggggcgagcgtggcagtgtct
acagggctagcgggctgcacagtgagcaattcagcaaatagccaaccgcaaactaacgct
acctttactcatggggtggctagtggcgacccattaaaagacgccgtgattatttggacg
cgcgccgtgcccacagaaggttcgggtttagccaaagccgatattttgtgggaaatggcg
agcgatgccgactttaccaacgtggtcagtagcggcattgttgaggcgaaagcaacacat
gacttcaccgttaaaatagacgttactggtcttagccccgctcgccattatttttaccgt
tttaaaagcgctaataatacaagcccagtaggtgaaacccgtacgctacctgaatccgat
gtatctaacgtcacgttcggcatattttcttgctctaattaccctgcaggctttttcaca
ccttatatggaggcagcaaaaaacgacaacatcgattatgtattgcaccttggtgactac
atttacgaatacgatggcaagggttatgcgactgagcatgcaaaagagattggccgaact
tatgcccccgataacgataccgagctttatacgctaaccgactatcgcaaccgctatgcg
ctatatcgcacggatgaaggcttgttagcattacaccaaaacaagccatttattgttgtg
tgggatgatcatgaaattactaacgacacctataaagacggtgctgaaaatcaccaggta
gatgaaggtgatttttatgaacgccgcgctgcggccgtacaagcttattatgagtggcta
cccattcgcccaccatttggcacagagcgtttagaaatttatcgccagtttacctttggt
aagcttcttgacttatacatgctcgacacccgcgttcttgcccgcgataagcagcttgag
tacggcgactatcgcgatgctgaaactaaagcgtttgatcaagcccgctttatgaaagac
attggcaacccgaaccgcggtttactcggtgaaacccaacgcaactggctacattcgtct
atgcagcaaagccaggctaaatggcaggtgttagggcaacagctattaataggccgcatg
cttttccctgtatctatttttaacggcgttgaacgcaaagcaatacctgcccatgtacac
aaacttgcgaatattaaacgcaaacaaatgcaaggtggcgcactcagtgaacaagagcag
gcgcttattaataccgtaatgccatataacctagacgcgtgggatggctaccctgttgag
cgggaacaggttctgatgcagctgaaatccatcggcaagccagttattgcccttgcaggt
gatacacataacgcttggcacaataagttaaccctgaaagatggcacacaagtgggcatt
gagcttgctacaccgggtgtgacatcgcccggtatggaacattacttaagtatggatgat
gaaatggcagaaacccttgccgatgaccttccgcttcttattgaagacttgcagtactgt
aatcttcaccagcgcggctttatgacattgaccgttagcgaagacagcgcaacagccact
tggcactatgtggatgcgattttgaccaaggtaggaaaagtggttaatacgcatagctat
gagattaaggcatag

DBGET integrated database retrieval system