KEGG   Alteromonas macleodii English Channel 673: AMEC673_17465Help
Entry
AMEC673_17465     CDS       T02254                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMEC673_17465
Enzymes [BR:amg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AMEC673_17465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4107737..4108234
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGVGSNLGDSRGKAQRAFDAIGQIEDTRVLKTSSLYSSKPMGPQDQPDYINAV
CLIETSLKPHGLLKQLQRIELEKGRERKGERWGPRTLDLDILLYGSETIDTADLIIPHYG
MAEREFVMVPLFEIAPNMVMHDGKPISAWVANCSLDGLRRLRSSN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagagcacgtttacattggtgtaggtagcaacctcggcgatagccggggaaaa
gcccagcgcgcgtttgatgcgataggtcaaatcgaagacacccgcgtacttaaaacctct
tcactttattctagtaaaccgatggggccgcaagaccaacctgactatattaacgcggtg
tgcttaattgagacctcgttaaagccccacggcttattgaagcagctgcaacgcattgag
ctggaaaaaggccgtgagcgcaaaggtgagcgctggggtccacgcacgttggatttggat
attttgttgtacggcagcgaaactatcgacaccgcagacttaatcattccccattacggc
atggcagagcgcgagttcgttatggtgccgctgtttgaaattgcgcccaatatggttatg
cacgatggcaaacccatctcggcatgggtcgctaactgctcgctggatggacttcgtcgc
ctgcgctcttccaattag

DBGET integrated database retrieval system