KEGG   Alteromonas macleodii English Channel 615: I633_02355Help
Entry
I633_02355        CDS       T02719                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
amh  Alteromonas macleodii English Channel 615
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amh00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:amh00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
466387..467862
Genome map
AA seq 491 aa AA seqDB search
MSKCPFSGTAINPTTLTSSNGAPVANDNQSRTAGPRGPVTFDNHYLFEKLAHFNRERIPE
RVVHARGSAAYGTFTLTKSLSDYTIADFLQQEGQQTNVFLRFSTVGGGQDSSDYARDPRG
FSVKFYTEQGNWDMVGNNTPVFFLRDGIKFPDFIHSQKKNPRTNLPDPQAVYEFWANNPQ
SLHQSTILMSDRGIPLSYRHVNGYSSHTLSLWNKAGERYWVKWHFKTNQGIKTLTNEEAA
RMPAYGAQQDLVESIDNGDFPSWTVNVQIMTEEEARNYRINPFDLTKVWPHSDFPLIEVG
QLELNRNVENYFAETEQAAFAPSNLVPGIGVSPDRMLQARLIGYQDAHRYRIGANYNQIP
VNAPRCPVHNYQRDGAFAGVNPALAGSGANFYPNNRARVGEPAEAPEVQEPPMPLEQDAW
LDIYDNRDEDNYSQAGDLYRIMSEDQKQQLVNNIADGLSQATQDVQEAMFVQYDLADKDY
GARVRKAVASR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtgtccattttcaggtacagctataaaccctaccacgctaacgtctagcaat
ggtgcgcccgttgctaatgacaaccaaagtcgcaccgccggacctcgtggccctgttact
ttcgacaaccactatttattcgagaagcttgcgcactttaaccgcgagcgcattcctgaa
cgcgtagttcacgctagaggtagtgcagcgtatggtacttttacgcttactaagagttta
tccgattacaccattgccgactttcttcagcaagaaggacagcaaactaacgtctttcta
cgtttctctacagtaggtggtggtcaagattcaagcgactacgctcgcgacccccgtggt
ttttctgtgaagttttacaccgaacagggcaactgggatatggtgggcaataatacgcca
gtgtttttcttgcgagatggcattaagttccctgattttatacacagccagaaaaagaac
ccgcgaactaacttaccagatccgcaggcggtatatgagttttgggcgaacaatccgcag
tcattacaccaatcaacaattttgatgtcagatcgtggtattccgctgtcttatcgccac
gtgaacggctacagctctcatacattgagtttatggaataaagccggtgagcgctattgg
gtgaagtggcactttaaaactaaccaaggtatcaaaacgctcacgaacgaagaagcagcg
agaatgcctgcttacggtgcgcagcaagaccttgttgaaagtatcgataacggtgacttt
ccatcttggactgtaaacgttcaaattatgacggaagaagaagcgcgtaattaccgtatt
aacccgtttgacttaacaaaggtatggccacacagcgacttcccgttgattgaagtgggg
caactggagttaaatcgcaatgtggaaaattattttgcagaaacagagcaagcagcgttt
gcgccgagcaatttggtaccgggtattggcgtgtcgccagacaggatgctacaagcgcga
ctaattggatatcaagatgcgcacaggtaccgtattggcgctaattacaaccaaataccg
gtaaatgcgccacgctgtccagtgcacaattatcagcgtgacggtgcgtttgcaggcgtt
aatccagcacttgcgggaagtggagcaaacttctatccaaataaccgtgcgcgagttggt
gagccagccgaagcgccagaagtacaagagccaccaatgccgctagagcaagatgcatgg
ttagatatttatgataaccgtgatgaagacaactactcccaggcaggcgatttgtaccgc
attatgagtgaagatcagaaacagcagttggtaaacaatattgctgatggtctaagccaa
gctacacaagacgtgcaagaagctatgttcgtgcaatacgacttagccgataaagactac
ggcgcccgtgtaagaaaggcggtagccagcagatag

DBGET integrated database retrieval system