KEGG   Alteromonas macleodii English Channel 615: I633_09865Help
Entry
I633_09865        CDS       T02719                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
amh  Alteromonas macleodii English Channel 615
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amh00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    I633_09865
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I633_09865
   00330 Arginine and proline metabolism
    I633_09865
Enzymes [BR:amh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     I633_09865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1988617..1989759)
Genome map
AA seq 380 aa AA seqDB search
MNSEGNIEVNQGWRVQHNSAMGPYKGGLRFHPTVNLSVLKFLAFEQCFKNALTGLPMGGG
KGGSDFNPKGRSDRDIMLFCQAFMRELQRHIGANTDVPAGDINVGAREIGYLYGEYRRLN
NKFEGVLTGKGLEFGGSYVRTEATGFGLIYFLDAVCQYKKTDLKVKTVTVSGAGNVALHA
ALKAVEKGAKVISLSNSRGLLHSESGLSDKNLRWAIENHASSENILYDMAEQNMGAWVAD
KKPWHLKCDIALPCATQNELQEEDANALLNNGCKMVLEGANMPCTTDAQKQFFDAKITYV
PGKASNAGGVALSGLEMGQNAMFNQRDASALDEQLCSIMNSIHERCVIEGKREDGHVDYM
KGANIAAFRRLADAMLAQGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgaaggtaacattgaagtaaatcagggatggcgtgtacaacacaactcagcg
atggggccatataaaggcggtctacgctttcaccctaccgtaaatttatccgtgcttaaa
ttcctagcgtttgaacagtgctttaaaaatgcattgaccgggctaccaatgggtggagga
aaaggcggctcagattttaaccctaaggggcgttcagatcgtgacatcatgttgttttgc
caagcatttatgcgtgagttgcaacgacatataggcgcaaataccgatgtacccgcaggc
gacattaacgtgggggcaagagaaattgggtatttatatggtgaataccgcaggttaaat
aataagtttgaaggcgtactcaccggcaaaggcttagagtttggtggtagctatgttcga
accgaagcaacaggttttggcctcatctactttttagatgcggtgtgccagtataaaaag
accgaccttaaggtcaaaacagtgacagtatcgggagccggaaatgtcgcccttcatgcc
gccttaaaagccgttgaaaaaggcgctaaggtaatttcactatctaacagccgagggctt
ttacatagtgagagcggattaagtgataaaaacctgaggtgggcaattgaaaatcatgct
tcaagtgaaaacatactctatgacatggctgaacaaaatatgggggcgtgggtagcggat
aaaaaaccttggcaccttaaatgcgacatagcgctcccctgtgccacgcaaaacgaactg
caagaagaagatgccaacgcactgcttaacaacggatgtaaaatggtattagaaggtgcc
aatatgccttgcactaccgacgcgcaaaaacagttttttgacgccaaaataacctacgta
ccgggcaaggcatctaatgctgggggcgttgcactttcaggcttagaaatgggtcaaaat
gctatgttcaatcagcgtgacgccagcgcgttagacgaacagctttgctcgattatgaac
agtattcacgaacgctgtgtaatcgaaggtaagcgtgaagatggccatgtcgattatatg
aagggagcgaatattgcggctttcaggcggctcgccgatgccatgctagcgcaaggtgtt
taa

DBGET integrated database retrieval system