KEGG   Alteromonas mediterranea 615: I633_10255Help
Entry
I633_10255        CDS       T02719                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00020  Citrate cycle (TCA cycle)
amh00310  Lysine degradation
amh00380  Tryptophan metabolism
amh01100  Metabolic pathways
amh01110  Biosynthesis of secondary metabolites
amh01120  Microbial metabolism in diverse environments
amh01130  Biosynthesis of antibiotics
amh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    I633_10255 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    I633_10255 (sucA)
   00380 Tryptophan metabolism
    I633_10255 (sucA)
Enzymes [BR:amh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     I633_10255 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N PFOR_II DUF2156 SARS_X4
Motif
Other DBs
NCBI-ProteinID: AGP78037
UniProt: S5ACP9
Position
2061096..2063915
Genome map
AA seq 939 aa AA seqDB search
MQESVMKAWWDSSHMAGANAAYVEELYETYLEDPQSVSENWRQIFDNLPKVDGVELETNH
TTIKNQFRQLAALGPTARMSSPSSPSANVSDDRQVKVLQLINAFRFRGHQHANLDPLGLW
QQERVRDLELSHHSLSEQDFDSVFNVGSYAIGKESMPLGELFKSLNRTYCGSIGAEYMHI
TDTEQKRWLQQKIESVQAKPEISRDEKLGILKGLTAADGMEKYLGSKFPGAKRFSLEGGD
ALIPMLKGLITKAGTAGTKEVVIGMAHRGRLNVLVNVLGKNPSVLFDEFSGKHDDSLGAG
DVKYHAGFSSDFATPGGNVHLALAFNPSHLEIVNPVVMGSVRARLARRDNDTNTVLPITI
HGDSAIAGQGVVQETFNMSQTRGFAVGGTVRIVVNNQVGFTTSKTEDTRSTQYCTDIAKM
VQAPIFHVNSDDPEAVAFVTQLALEYRNKFKKDVVIDLVCYRRHGHNEADEPNATQPLMY
QKIKKHPVPRVLYADQLIAEGVIEQRDADRYLEEYREALDHGACVVEEWRPMTEHSVDWS
PYLGHDWDTPYDGALSVEKLKELGESITTIPEDHKLQSRVNKLYQDRKAMVAGEKKLDWG
MAENLAYATIVDAGEDIRITGQDSGRGTFFHRHAVLHNQKDASTYMPLQHIREGQGEIEI
YDSVLSEEAVMAFEYGYATAEPTCLTIWEAQFGDFANGAQVVFDQFLSSGEAKWGRLCGL
TVLLPHGYEGQGPEHSSARLERFLQMCADHNWQVCVPSTPAQVYNMLRRQVVRPMRKPLI
VMSPKSLLRHPMAVSSLEELAEGKFHNVIDEIDDIDPKNVKRVVMCSGKVYYDLLDQRRK
NEQTDVAIIRLEQLYPFPQEECAKVVAQYSHVKDWVWCQEEPQNQGAWYCSQHHFWQAIP
DGAKLTYAGRDASSSPAVGYVSVHNQQQKALVENALTIK
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaagcgtgatgaaagcgtggtgggattcctcgcacatggcaggtgccaacgct
gcctatgttgaagagttgtatgaaacctatttagaagacccgcaaagtgtctctgaaaat
tggcgacaaatcttcgataacctccccaaagtcgatggcgtagagttagaaaccaatcat
acaactattaagaatcaatttaggcaacttgctgcgttagggccaaccgcccgcatgtct
agtccgtcttctccttctgctaatgtctcagacgacaggcaagttaaagtccttcagtta
attaacgcgttccgcttccgcggtcaccaacacgcaaacttagacccacttggtctatgg
cagcaagagcgtgtgcgcgacttagaactttctcaccacagcctatctgagcaagatttc
gattcggttttcaacgtgggttcttatgctatcggcaaagagtcaatgccacttggagaa
ctgtttaaatcgcttaacagaacttactgcgggtctatcggtgcagagtacatgcacatt
accgacactgaacaaaagcgttggttacagcaaaagatagaatctgttcaggccaagcct
gaaatttctcgtgatgagaagttaggtattcttaaaggtcttactgcggccgacggcatg
gaaaaatacttgggttctaaattcccaggtgcaaagcgtttctctctagaaggcggcgat
gcgctaattcctatgcttaaaggcttgatcacaaaagcgggcactgcgggtaccaaagaa
gtggttatcggcatggctcaccgtggtcgattgaacgtattggtgaacgtactgggtaaa
aacccgtcagtactgtttgacgaattctctggtaaacacgacgactcgctaggtgcgggt
gacgtgaaataccacgccggtttctcttcagactttgcaacgccaggtggcaatgttcac
ctagcgctagcgtttaacccgtctcaccttgaaattgttaacccggtagttatggggtcg
gtacgcgctcgtttagcacgtcgtgataacgacactaacacagtgttgccaataactatc
cacggtgactctgctattgcgggtcagggtgtagttcaagaaacctttaatatgtcacaa
actcgcggctttgctgtgggtggtaccgttcgcattgtggtaaacaaccaagttggcttt
accacgtcgaaaacagaagatacccgttcaacgcaatactgtaccgacatcgcgaaaatg
gtgcaggcgccaattttccatgttaactcagatgacccagaagcggttgcctttgttaca
cagcttgcgcttgagtatcgcaacaagtttaagaaagacgtggtaattgaccttgtttgt
taccgtcgtcatggtcacaacgaagcggatgagccgaatgcaacgcagccgttgatgtac
caaaaaattaaaaagcaccctgtaccgcgtgtgctatatgctgaccaacttatagctgaa
ggcgtaattgagcaacgggatgcagaccgctaccttgaagagtatcgtgaagcgttggat
cacggcgcttgtgttgtagaagagtggcgtccaatgaccgagcacagtgttgactggtct
ccatatcttggacacgactgggatacgccttacgatggcgcactttcagttgagaagctt
aaagagctaggtgagtcaatcactactattcctgaagatcataagcttcagtctcgtgta
aataagctgtaccaagaccgtaaggctatggttgcaggcgagaagaagttagattggggg
atggctgaaaacttagcctatgccactatcgttgacgccggcgaagatattcgcattacg
ggtcaggattctggccgtggtactttcttccaccgtcacgcggtattacacaatcaaaaa
gacgcatcgacgtatatgcctctgcagcatattcgtgaaggtcagggtgaaattgaaatt
tacgactctgtgctttcggaagaagcagtaatggcatttgaatacggctatgcgacggca
gagccaacgtgcctgaccatttgggaagcccagtttggtgacttcgctaacggcgcacag
gttgtattcgaccaattcttaagttcaggtgaagcaaagtggggccgtttgtgtggtcta
accgttttacttccacatggttatgaaggtcaaggcccagagcatagttctgcacgcctt
gaacgtttccttcagatgtgtgctgatcacaactggcaagtgtgtgtgccttctacacct
gcacaggtatacaacatgcttcgtcgccaagtggttcgcccaatgcgtaaaccgcttatc
gtcatgtcgcctaagtcattattacgtcacccaatggcggtatcttcgttagaagagcta
gcggaaggtaaattccacaacgtgatagatgaaattgacgacattgatccgaagaacgtg
aagcgtgttgttatgtgttcgggcaaggtttactacgatttgttagaccagcgacgtaaa
aatgagcaaacagacgttgcaatcatccgtttagagcaactttatccattcccacaagaa
gaatgcgctaaagttgtggcacaatacagccatgtaaaagattgggtttggtgtcaagaa
gagcctcaaaaccaaggcgcttggtactgtagccaacaccatttctggcaagcaattcca
gatggtgcgaaattaacatatgcaggccgtgatgcatcctcgtcacctgcagtaggttat
gtatccgttcacaaccagcaacagaaagccctggttgaaaacgcactcacaattaaataa

DBGET integrated database retrieval system