KEGG   Alteromonas macleodii English Channel 615: I633_14780Help
Entry
I633_14780        CDS       T02719                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
amh  Alteromonas macleodii English Channel 615
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    I633_14780
Enzymes [BR:amh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     I633_14780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3013950..3014531
Genome map
AA seq 193 aa AA seqDB search
MAQLYFYYSAMNAGKSTSLLQSAYNYRERGMHSIIYTAALDDRYGVGKVTSRIGLQADAK
LYSKDDDLFTSIRLDCEKRKPDCVFIDEAQFLTKAQVRQLVEAVDELDVPVLAYGLRTDF
LGETFEGSHYLLAWADKLFELKTVCHCGRKANFVVRLDENGNAVKNGDQVQIGGNDTYES
MCRKHFKALVWDE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaactttatttttactactctgcgatgaacgcggggaaatcgacatcgcttctt
caatcagcatacaactatcgcgaacgcggtatgcactctatcatatacactgcagcgcta
gacgaccgttacggtgtgggaaaagtcacctctcgaattgggcttcaggccgacgccaag
ctgtattcgaaagacgacgacctgttcacgtcaattcgactagactgtgaaaagcgtaaa
ccggattgtgtgtttatagatgaagcacagtttttaacaaaggcgcaagtcaggcagctc
gtagaagcagtcgatgaattggacgttccagtacttgcttacggcctgagaactgacttt
ttaggggaaacctttgaaggcagccattacctgcttgcttgggctgacaaactgttcgaa
ttgaaaaccgtttgtcactgcggccgaaaagctaactttgtagtcaggttagatgaaaat
ggtaatgcagttaaaaatggcgaccaagttcaaattggcggtaatgacacgtacgagtct
atgtgcagaaaacattttaaagcgctagtttgggatgagtaa

DBGET integrated database retrieval system