KEGG   Alteromonas mediterranea 615: I633_17600Help
Entry
I633_17600        CDS       T02719                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
amh  Alteromonas mediterranea 615
Brite
Enzymes [BR:amh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     I633_17600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3602363..3603463)
Genome map
AA seq 366 aa AA seqDB search
MVTGFKATKTLLAIALTLLLVSCSTKEDNAFKSQFMAYKALFIDGGRVVDTGNDEVSHSE
GQGYGMLFAVAADDKDTFDALWHWTQRTLLRSDGLFSWRYRPCADNSESCIDDPNNASDG
EILIAWALLRASEKWGIKGYQDEAGKIVQAVEQKLLVEHQGSVMLLPGEYGFTSQSEGQK
SLQLNLSYWVFPALTDLSALSNTPSRWQKLHQTGLTLLSNMQFSSYQLPSDWVRFEPRNS
GSAKSGLSGELTLTNVVSAEFGFNAIRIPLQLAWSVQVRDNAALAEELFAPYYQWWAKTP
TPATVNLLTEQTAEYEMTPGMQSVKLAVKYLMKSEEPVWPTVNRKMDYYSASLTLLSMLA
VSDNAS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccggatttaaggcaacaaaaacgctgctggcgatagcactaaccctattgtta
gtgtcgtgctccacaaaagaagacaatgcttttaaatcgcaatttatggcgtataaagcg
ctatttatcgacggcgggcgtgtggtagatacgggaaacgatgaggtgtcgcacagcgaa
gggcaaggttatggcatgttattcgctgtagcagccgacgacaaagataccttcgatgcc
ctatggcactggacccagcgcacgcttttgcgcagcgatgggcttttcagctggcgatat
cgcccatgtgccgataattcggagtcgtgtatagacgacccgaataatgcatcagatggc
gagattttaattgcatgggccttgttacgggccagtgaaaaatggggaataaagggatat
caagacgaagcgggtaagattgttcaggctgtagagcaaaagctgttggtagagcatcaa
ggtagcgtgatgttactacctggtgagtacggcttcacctcacaaagcgaggggcaaaag
agcctccagcttaatctgtcatactgggtttttcccgcacttacagatttatctgcctta
tccaatacaccgtcgcgatggcaaaagctccatcaaactgggcttactttgctttcgaac
atgcaattttcatcctatcaactgccaagcgactgggtgcgttttgaaccccgcaatagt
ggttcagcaaagtcaggtttatccggtgagctcaccctaaccaacgtggtatctgcagag
tttggctttaacgctattcgcattccgctgcagttggcatggtccgtacaggtccgagac
aacgcggcattagccgaagaactttttgcgccctattatcaatggtgggctaaaacgcct
actccagccactgttaatctacttaccgagcaaaccgctgaatatgagatgacacccggc
atgcagtcggtgaagttagccgtcaagtaccttatgaaatctgaagaaccagtgtggcca
acagttaatcgcaagatggactattactcggccagtttaacgctgctctctatgctagcg
gtgtcggataacgcatcgtga

DBGET integrated database retrieval system