KEGG   Actinosynnema mirum: Amir_0203Help
Entry
Amir_0203         CDS       T00957                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
ami  Actinosynnema mirum
Pathway
ami03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ami00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Amir_0203
DNA repair and recombination proteins [BR:ami03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Amir_0203
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Amir_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 Toprim_2 HHH_8 zinc_ribbon_2 zf-HIT
Motif
Other DBs
NCBI-ProteinID: ACU34174
JGI: Amir_0203
UniProt: C6WF42
Position
218149..218742
Genome map
AA seq 197 aa AA seqDB search
MYEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAAEPADIGRLQDALQKVKEGVVFCEVCG
NVSAETTCRICRDPRRDLTLICVVEEPKDVLAVERTREFKGRYHVLGGALDPLSGIGPDQ
LRIRQLLTRIGTDVSEIIIATDPNTEGEATATYLVRMLRDFPGLSVTRLASGLPMGGDLE
FADELTLGRALSGRRSL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggcccggtccaggacctgatcgacgagctcggccgactgccgggcgtgggt
cccaagagcgcgcagcgcatcgccttccacctgctggccgcggagcccgcggacatcggc
aggctgcaggacgccctccagaaggtgaaggagggcgtggtcttctgcgaggtgtgcggc
aacgtctcggccgagacgacctgccgcatctgccgcgacccgaggcgcgacctcacgctc
atctgcgtggtggaggagccgaaggacgtcctcgcggtcgagcggacccgcgagttcaag
ggccgctaccacgtgctgggcggcgcgctcgacccgctgtccgggatcgggccggaccag
ctgcggatcaggcagctgctcaccaggatcgggaccgacgtcagcgagatcatcatcgcg
acggacccgaacaccgagggcgaggcgaccgccacctatctggtgcggatgctgcgcgac
ttccccggtctgtccgtgacgcggctggcctccggcctgccgatgggcggtgacctggag
ttcgcggacgagctgacgctggggcgcgccctgtccgggcgccggagcctctga

DBGET integrated database retrieval system