KEGG   Actinosynnema mirum: Amir_0314Help
Entry
Amir_0314         CDS       T00957                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ami  Actinosynnema mirum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Amir_0314
Enzymes [BR:ami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Amir_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
344985..345614
Genome map
AA seq 209 aa AA seqDB search
MIEFDNAGLPSNGEAGVAAKRPFDQERAEAAVRELLLACGEDPEREGLRETPARVARAYR
EMFAGLFTEPDGVLAKTFDESHEELVLVTEIPVYSFCEHHLLPFHGVAHVGYIPNEQGRV
TGLSKLARLVDLYAKRPQVQERLTSQVADALVRRLEPRGVIVVVEAEHLCMGMRGVRKPG
SRTTTSAVRGLLRTSASSRAEAISLIKGR
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaattcgacaacgccggtctccccagcaacggggaggccggcgtcgccgcgaag
cggcccttcgaccaggagcgcgccgaggccgccgtgcgcgagctgctgctcgcctgcggc
gaggaccccgagcgcgagggactgcgcgagacgcccgcgcgggtcgcgcgggcctaccgc
gagatgttcgccggcctgttcaccgagccggacggcgtgctggccaagaccttcgacgag
agccacgaggaactcgtcctggtcacggaaatcccggtctactcgttctgcgagcaccac
ctgctgccgttccacggcgtcgcgcacgtcgggtacatcccgaacgagcagggccgcgtc
accgggctgtccaagctggcccggctggtcgacctgtacgccaagcgcccccaggtgcag
gagcggctgacctcgcaggtcgccgacgcgctcgtgcgcaggctggagccgcgcggcgtc
atcgtcgtggtcgaggccgagcacctgtgcatggggatgcgcggcgtgcgcaagcccggc
tcgcgcaccaccacctccgccgtgcgcggcctgctgcgcacctcggcgtcctcgcgcgcc
gaggccatctccctgatcaaggggcgctga

DBGET integrated database retrieval system