KEGG   Actinosynnema mirum: Amir_0315Help
Entry
Amir_0315         CDS       T00957                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ami  Actinosynnema mirum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Amir_0315
Enzymes [BR:ami01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Amir_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
345653..346438
Genome map
AA seq 261 aa AA seqDB search
MGVLNVTADSFSDGGRYLGLADAVAHGLALRDQGAHLVDVGGESTRPGAERVPSDLEVAR
TSHVIAALSAQGVVTSVDTTRSEVAVAALEAGVSVVNDVSGGLADPDMLRVVAEADVPYV
VMHWRGHSAGMDRLAEYSDVVREVRDELSARVDAALAAGVRAENVVVDPGLGFAKRAEHN
WQLLNRLDELIDLGFPVLVGASRKRFLGALLGERPPAGREDATAAVSALAAFNGAWGVRV
HDVPRSVDAVAVAGAWRAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcctgaacgtcaccgccgactcgttctccgacggcggtcgctacctgggcctt
gccgacgccgtcgcgcacgggctggccctgcgcgaccagggcgcgcacctggtcgacgtg
ggcggcgagtccaccaggccaggagccgagcgggtgccgagcgacctggaggtcgcccgc
acctcgcacgtgatcgccgcgctgtccgcgcagggggtggtgaccagcgtggacaccacc
cgctccgaggtggccgtcgccgcgctggaggccggggtgtcggtggtcaacgacgtgtcc
ggcggcctggccgacccggacatgctgagggtcgtcgccgaggcggacgtgccgtacgtg
gtcatgcactggcgcgggcacagcgcaggcatggaccggctcgccgagtactccgacgtg
gtgcgggaggtccgcgacgagctgtccgcccgcgtggacgccgccctcgccgccggggtg
cgggccgagaacgtggtggtcgaccccggcctgggcttcgcgaagcgcgccgagcacaac
tggcagctgctgaaccggctggacgagctgatcgacctcggcttcccggtgctggtcggc
gcctcccgcaagcggttcctcggcgccctgctgggcgagcggcccccggcgggccgggag
gacgcgacggcggccgtgtcggcgctggccgcgttcaacggcgcctggggcgtgcgggtg
cacgacgtgccgcgctcggtggacgcggtggccgtcgcgggcgcgtggcgggccggtcgt
ggctga

DBGET integrated database retrieval system