KEGG   Actinosynnema mirum: Amir_0317Help
Entry
Amir_0317         CDS       T00957                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ami  Actinosynnema mirum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ami00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
346805..347281
Genome map
AA seq 158 aa AA seqDB search
MSRAVLSLGSNLGDRLAHLRSAVDGFRPWLLAASPVYETAPWGVTDQDDFLNAVLLVEGD
LDEWGWLRRGQELERAAGRVRERRWGPRTLDVDVVAVDDVRSEDPELLLPHPGAHERATV
LAPWLDVDPDAVLPGHGRVADLLSGVDLSGVRRLEVAL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcgccgtgctgtccctcggctccaacctcggcgaccggctcgcccacctgcgc
tcggccgtcgacggcttccggccgtggctgctcgccgcctccccggtgtacgagaccgcc
ccgtggggcgtcaccgaccaggacgacttcctcaacgccgtcctgctcgtcgagggcgac
ctggacgagtggggctggctgcgccggggccaggagctggagcgggccgccgggcgggtc
agggagcgccgctgggggccgcgcacgctcgacgtggacgtggtggccgtggacgacgtg
cggtccgaggaccccgagctgctgctgccgcaccccggcgcgcacgagcgggccaccgtg
ctggcgccctggctggacgtcgacccggacgcggtgctgccggggcacgggcgggtcgcc
gacctgctgtccggggtggacctgtccggggtgcggaggctggaggtcgcgctgtga

DBGET integrated database retrieval system