KEGG   Actinosynnema mirum: Amir_0628Help
Entry
Amir_0628         CDS       T00957                                 

Definition
Nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ami  Actinosynnema mirum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amir_0628
   00052 Galactose metabolism
    Amir_0628
   00500 Starch and sucrose metabolism
    Amir_0628
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_0628
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Amir_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
690808..691689
Genome map
AA seq 293 aa AA seqDB search
MSAFTTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPGIELVATEAAEAGATKLIIVTSPG
KESVAQYFRPQPELEETLESRGKTDLVAKVRRAPALLDVETALQEKALGLGHAVGCAEAN
LTDADEAVAVLLPDDLVLPTGVLSRMAAVRDRFGGSVLCAFDIPREQISAYGVFDVNDTD
DDDVKQVVGMVEKPKAEDAPSTYAAAGRYLLDRAIFDALKRITPGAGGELQLTDAIALLI
SEGHPVHVVVHRGGRHDLGNPGGFLKAAVDFALEHPDYGPELGEWLRGRLGNS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttcacgacagcaatcgtgcccgcggccgggttgggcacccgcttcctcccg
accaccaaggccgtgcccaaggagctgctgccggtcgtcgacacccccggcatcgaactc
gtcgccaccgaggcggccgaggcgggcgccaccaagctgatcatcgtcacctcccccggc
aaggagtcggtggcgcagtacttccgcccccagcccgagctggaggagaccctggagagc
cgcggcaagaccgacctggtcgccaaggtccgccgcgcccccgccctgctcgacgtggag
accgcgctccaggagaaggcgctcggcctcggccacgccgtcggctgcgccgaggccaac
ctgaccgacgccgacgaggccgtcgccgtgctgctgcccgacgacctggtgctccccacc
ggcgtgctctcccgcatggccgccgtccgcgaccgcttcggcggcagcgtgctgtgcgcg
ttcgacatcccgcgcgagcagatctccgcgtacggcgtgttcgacgtgaacgacaccgac
gacgacgacgtcaagcaggtcgtcggcatggtcgagaagcccaaggccgaggacgccccg
tccacctacgccgccgcgggccgctacctcctcgatcgggcgatcttcgacgccctcaag
cggatcacccccggcgcaggcggcgagctccagctcaccgacgccatcgcgctgctgatc
tccgagggccacccggtgcacgtcgtggtccaccgcggtgggcgacacgacctgggcaat
ccgggaggtttcctcaaggctgcggttgacttcgcgttggagcacccggactacgggccc
gagctcggtgagtggttgcggggtcgcctcggcaactcctga

DBGET integrated database retrieval system