KEGG   Actinosynnema mirum: Amir_0628Help
Entry
Amir_0628         CDS       T00957                                 

Definition
Nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ami  Actinosynnema mirum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ami00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ami00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ami00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ami00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
690808..691689
Genome map
AA seq 293 aa AA seqDB search
MSAFTTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPGIELVATEAAEAGATKLIIVTSPG
KESVAQYFRPQPELEETLESRGKTDLVAKVRRAPALLDVETALQEKALGLGHAVGCAEAN
LTDADEAVAVLLPDDLVLPTGVLSRMAAVRDRFGGSVLCAFDIPREQISAYGVFDVNDTD
DDDVKQVVGMVEKPKAEDAPSTYAAAGRYLLDRAIFDALKRITPGAGGELQLTDAIALLI
SEGHPVHVVVHRGGRHDLGNPGGFLKAAVDFALEHPDYGPELGEWLRGRLGNS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttcacgacagcaatcgtgcccgcggccgggttgggcacccgcttcctcccg
accaccaaggccgtgcccaaggagctgctgccggtcgtcgacacccccggcatcgaactc
gtcgccaccgaggcggccgaggcgggcgccaccaagctgatcatcgtcacctcccccggc
aaggagtcggtggcgcagtacttccgcccccagcccgagctggaggagaccctggagagc
cgcggcaagaccgacctggtcgccaaggtccgccgcgcccccgccctgctcgacgtggag
accgcgctccaggagaaggcgctcggcctcggccacgccgtcggctgcgccgaggccaac
ctgaccgacgccgacgaggccgtcgccgtgctgctgcccgacgacctggtgctccccacc
ggcgtgctctcccgcatggccgccgtccgcgaccgcttcggcggcagcgtgctgtgcgcg
ttcgacatcccgcgcgagcagatctccgcgtacggcgtgttcgacgtgaacgacaccgac
gacgacgacgtcaagcaggtcgtcggcatggtcgagaagcccaaggccgaggacgccccg
tccacctacgccgccgcgggccgctacctcctcgatcgggcgatcttcgacgccctcaag
cggatcacccccggcgcaggcggcgagctccagctcaccgacgccatcgcgctgctgatc
tccgagggccacccggtgcacgtcgtggtccaccgcggtgggcgacacgacctgggcaat
ccgggaggtttcctcaaggctgcggttgacttcgcgttggagcacccggactacgggccc
gagctcggtgagtggttgcggggtcgcctcggcaactcctga

DBGET integrated database retrieval system