KEGG   Actinosynnema mirum: Amir_0649Help
Entry
Amir_0649         CDS       T00957                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ami  Actinosynnema mirum
Pathway
ami00900  Terpenoid backbone biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01130  Biosynthesis of antibiotics
Module
ami_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Amir_0649
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Amir_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACU34612
JGI: Amir_0649
UniProt: C6WJI0
Position
714738..715703
Genome map
AA seq 321 aa AA seqDB search
MLAVVPPPVTVRVPAKVNLHLAVGDLRDDGYHDLVTIFQALSLTDEVTVGASDDPGVEVR
GEGAESVPTDPSNLAWKAVRVLAEHTGRDPEDVKVRVGIRKAIPVAGGMAGGSADAAATL
VALAALWKLDTTRDELAELAGRIGADVPFALYGGTALGTDRGDRLVPVLGKHPFHWVLAF
DKQGLSTPEVFRELDRLRAEGNPPRVGEAEAVLEGLSSGDPRQLALLLGNDLQAAAVSLR
PNLRRTLRAGVNAGALAGMVSGSGPTCAFLCEDGDTAVRVAAELAGAGVCRTVRVAQGPV
PGARVVGAEESPRPTPPEVHA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgtagtcccacctccggtcaccgtccgcgtcccggccaaggtcaacctgcac
ctggccgtgggcgacctccgcgacgacgggtaccacgacctcgtcacgatcttccaggcg
ctctcgctcaccgacgaggtcaccgtcggcgcctcggacgaccctggggtcgaggtgcgc
ggggagggggcggagtcggtgcccaccgacccgtccaacctcgcctggaaggccgtccgg
gtgctggccgagcacaccggccgggaccccgaggacgtcaaggtcagggtcggcatccgc
aaggccatcccggtcgcgggcggcatggcgggcggctccgccgacgccgccgccaccctc
gtcgcgctggccgcgctgtggaagctcgacaccacccgcgacgagctggccgagctggcc
gggcggatcggcgccgacgtgccgttcgcgctctacggcggcaccgcgctcggcaccgac
cggggcgaccggctcgtgcccgtgctcggcaagcacccgttccactgggtgctggcgttc
gacaagcagggcctgtccacgcccgaggtgttccgcgagctggaccggctgcgcgccgag
ggcaacccgccgcgcgtcggcgaggccgaggccgtcctggagggcctgtcctccggcgac
ccgcgccagctcgcgctgctgctgggcaacgacctgcaggccgccgccgtgtcgctgcgg
cccaacctgcggcgcacgctgcgcgccggggtcaacgcgggggccctggcgggcatggtg
tccgggtccgggccgacctgcgcgttcctgtgcgaggacggcgacacggcggtgcgggtg
gcggcggagctggccggggcgggcgtgtgccgcacggtgcgcgtagcccaggggccggtg
cccggcgcgcgggtggtcggggccgaggagtcacctcgccccacgccgcccgaggtccac
gcttaa

DBGET integrated database retrieval system