KEGG   Actinosynnema mirum: Amir_0773Help
Entry
Amir_0773         CDS       T00957                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ami  Actinosynnema mirum
Pathway
ami00300  Lysine biosynthesis
ami01100  Metabolic pathways
ami01120  Microbial metabolism in diverse environments
ami01230  Biosynthesis of amino acids
Module
ami_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Amir_0773
Enzymes [BR:ami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Amir_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 ALS_ss_C
Motif
Other DBs
NCBI-ProteinID: ACU34735
JGI: Amir_0773
UniProt: C6WKY0
Position
854283..855362
Genome map
AA seq 359 aa AA seqDB search
MPGVADTLDLTADPVTLTVALVDVPSVSGDEQRIADLVERSLREQTALEVVRSGNTVLAR
TNLGRERRVVLAGHLDTVPVNDNLPSRLEDGVLHGLGSVDMKGGDAVMLALAGTLTDPRH
DLTFVFYDCEEVEASRNGLGRVERELPEWMSGDLAIVCEPSNGVIEAGCQGTIRVQVRAT
GKRAHTARGWMGVNAIHLLGDAIARLRDHESRVVEIDGCTYREGVQAVGITGGVSGNVVP
DECVLTVNHRFAPDRTPAQAEAYLRELFDGYEVTVTDFAAGALPGLASPAARELVEAAGG
APVAKLGWTDVARFAALGTPAVNFGPGDPLLAHTQQENVRVNEIGHCYEVLSRFLSAMP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggcgtggccgacacccttgacctcaccgccgatcccgtcacgctgaccgtcgcg
ctcgtggacgtgccgagcgtctcgggcgacgagcagcgcatcgccgacctggtcgagcgg
tccctgcgcgagcagaccgccctggaggtcgtccgctccggcaacaccgtcctggcccgc
acgaacctcggccgcgagcggcgcgtcgtgctcgcgggccacctggacaccgtgccggtc
aacgacaacctgccctcccgcctggaggacggcgtgctgcacggcctcggctcggtggac
atgaagggcggcgacgcggtcatgctggccctcgcgggcacgctcaccgacccgcgccac
gacctcacgttcgtgttctacgactgcgaggaggtcgaggcgagccgcaacggcctcggc
cgggtcgagcgcgagctgcccgagtggatgagcggcgacctggcgatcgtgtgcgagccg
tccaacggcgtcatcgaggcgggctgccagggcacgatccgggtgcaggtgcgcgccacc
ggcaagcgcgcccacaccgcgcgcggctggatgggcgtcaacgccatccacctcctcggc
gacgcgatcgcccggctgcgcgaccacgagtcgcgggtcgtggagatcgacggctgcacc
taccgggagggcgtgcaggccgtgggcatcaccggcggcgtctccggcaacgtcgtgccg
gacgagtgcgtgctgaccgtcaaccaccgcttcgcccccgaccgcaccccggcccaggcc
gaggcgtacctgcgggagctgttcgacggctacgaggtcaccgtcaccgacttcgccgcg
ggcgccctgcccggcctggcctcgcccgccgcgcgcgagctggtcgaggcggcgggcggc
gccccggtcgccaagctcggctggaccgacgtggcccgcttcgccgcgctcggcacgccc
gccgtgaacttcggccccggcgacccgctgctcgcccacacgcagcaggagaacgtccgg
gtgaacgagatcggacactgctacgaagtcctgtcgcgcttcctcagcgcgatgccctga

DBGET integrated database retrieval system