KEGG   Actinosynnema mirum: Amir_0777Help
Entry
Amir_0777         CDS       T00957                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ami  Actinosynnema mirum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Amir_0777
Enzymes [BR:ami01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Amir_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
858410..859270
Genome map
AA seq 286 aa AA seqDB search
MRFGTRDVPTDRALVMAIVNRTRDSFYDRGATFTDTAALAAVDRAVAEGADVVDIGGVRA
GARGEHVDAAEEARRVVPFVARVRERHPDLVISVDTWRHEVGRAVCEAGADLINDTWAGA
DPELAEVAAEFGVGLVCSHTGGLPPRTDPHRVRYADVVASVVEELVARAELVTSLGVPRA
GVLIDPTHDFGKNTWHGLELLRRLDELVDTGWPVLMALSNKDFIGETLDADVGDRVDGTL
AATALAARSGARVFRAHEVRRTRQVVDVVAAVAGTRPPARALRALA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcggcacacgcgacgtccccacagaccgcgcgctggtcatggcgatcgtcaat
cggacgcgggactccttctacgaccggggcgccaccttcaccgacaccgccgcgctggcc
gccgtcgaccgggcggtcgccgagggcgcggacgtcgtcgacatcggcggggtgcgcgcg
ggcgccaggggcgagcacgtcgacgccgccgaggaggcgcgccgggtcgtcccgttcgtc
gccagggtcagggagcggcaccccgacctggtgatcagcgtcgacacctggcggcacgag
gtcggcagggcggtctgcgaggcgggcgccgacctgatcaacgacacctgggcgggcgcc
gacccggagctcgccgaggtcgccgccgagttcggggtcggcctcgtctgctcgcacacc
ggcggactgccgccccgcaccgacccgcaccgcgtccggtacgccgacgtggtcgcctcg
gtcgtcgaggagctggtggccagggccgagctggtgacctcgctgggcgtgcccagggcg
ggcgtgctgatcgacccgacccacgacttcggcaagaacacctggcacggcctggagctg
ctgcggcggctggacgagctggtcgacaccggctggccggtgctgatggcgctgtccaac
aaggacttcatcggcgagaccctggacgcggacgtcggcgaccgggtcgacggcaccctc
gccgcgaccgcgctggccgcgcgcagcggcgcgcgggtgttccgcgcccacgaggtccgc
cgcacccggcaggtggtcgacgtggtcgcggccgtcgcgggcaccaggccgcccgcgcgg
gcgctgcgcgcgctggcctag

DBGET integrated database retrieval system