KEGG   Actinosynnema mirum: Amir_0840Help
Entry
Amir_0840         CDS       T00957                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ami  Actinosynnema mirum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Amir_0840
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Amir_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
923932..925077
Genome map
AA seq 381 aa AA seqDB search
MAGGGAAAAGPLAGFTVGVTAARRAEELVALLERKGAAVLHGPAIRIVPLHDDAKLLEAT
ELVLARQVDAVVATTGIGFRGWVEAAEGWGLGDRLLTALGDGLLLARGPKARGAVRAAGL
VEDWSPSSESNAELLEHLLGLGVAGKRIAVQLHGIPLPEFTGALREAGAEVVEVPVYRWT
GPADPGPLERLLEGVLSGQVDAMTFTSAPAAASVLETARQMGRYEEVLAALRRVLVVCVG
AIAAGPLVAVGVPVVQPGRARMGALAREVVVELPARAVRVPVEGREIELRGQGVLVDGEL
RPVAPAPMAVLRALVEARGRVVSRKELLAALPGGGEEHAVETAVGRLRTALGDPGVVATV
VKRGYRLAVEPSRFECGGVAV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcgggggtgctgccgctgccgggccgctcgcggggttcacggtgggggtcacc
gcggctcggcgggccgaggagctggtggcgctgctggagcggaagggcgctgcggtgctg
cacgggcccgcgatccggatcgttccgctgcacgacgacgcgaagttgttggaggccacc
gagctggtgctcgcccggcaggtcgacgcggtcgtggccaccaccgggatcgggttccgg
gggtgggtcgaggccgcggaggggtgggggctcggggatcggttgttgacggcgctcggg
gacgggttgctgttggcgcgggggcccaaggctcggggggctgtgcgggctgccgggctg
gtggaggactggtcgccttccagcgagtccaacgccgagcttctggagcatttgttgggg
ttgggggtggcggggaagcggatcgcggtgcagttgcacgggattccgctgccggagttc
accggggcgttgcgggaggccggggccgaggtggtggaggtcccggtctaccggtggacc
gggcccgctgacccggggccgttggagcggttgttggaaggggtgctgtcggggcaggtg
gacgcgatgacgttcacgtccgcgcctgcggcggcgtcggtgctggagacggcccggcag
atggggcggtacgaggaggtgctcgccgcgttgcggcgggtgctggtggtgtgcgtgggg
gcgatcgcggccgggccgctggtggcggtgggggttccggtggtgcagccggggcgggcg
cggatgggggcgttggctcgggaggtggtggtggagcttccggctcgggcggttcgggtt
ccggtggaggggcgggagatcgagctgcgggggcagggggtgctggtggacggggagttg
cggccggtcgcgcccgcgcccatggcggtgctgcgggcgttggtggaggcgcgggggcgg
gtggtgtcgcggaaggagttgttggcggcgttgccggggggtggggaggagcacgcggtg
gagacggcggtggggcggttgcggactgcgctcggggatccgggggtggtggcgaccgtg
gtgaagcgggggtaccggttggccgtcgagccgtcgcggttcgagtgcggtggggtggcg
gtgtga

DBGET integrated database retrieval system