KEGG   Actinosynnema mirum: Amir_0987Help
Entry
Amir_0987         CDS       T00957                                 

Definition
acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ami  Actinosynnema mirum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Amir_0987
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Amir_0987
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Amir_0987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1101154..1101723
Genome map
AA seq 189 aa AA seqDB search
MTLLTVWADENPDEVLLRTSEPDEVRAELERFGVRYERWPVLPDVTVDNALDAYREQVAR
VVETEGYVLVDAMHQTPSDDPEWLAAAAGARARFLAEHTHDDDEDRFFARGAGVFYLHVA
GRVHAVLCEAGDLLSVPANTTHWFDMGTRPDYVSIRFFHDDDGWVGNFTGSEIAKSFPTF
DELMAGRRG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgctgaccgtgtgggccgacgagaacccggacgaggtgctgctgcgcacctcg
gagccggacgaggtgcgggccgagctggagcggttcggcgtgcggtacgagcggtggccg
gtgctgccggacgtgaccgtcgacaacgcgctcgacgcctaccgcgagcaggtggcgcgg
gtggtggagaccgaggggtacgtgctggtcgacgccatgcaccagaccccgtccgacgac
cccgagtggctggccgccgcggcgggcgcgcgggcgaggttcctggccgagcacacccac
gacgacgacgaggaccggttcttcgcgcgcggggccggggtgttctacctgcacgtggcc
gggcgggtgcacgccgtgctgtgcgaggcgggcgacctgctgagcgtgcccgcgaacacc
acccactggttcgacatgggcaccaggccggactacgtgtcgatccggttcttccacgac
gacgacgggtgggtcgggaacttcaccgggagcgagatcgccaagtcgttcccgacgttc
gacgagctgatggccgggcgccggggctga

DBGET integrated database retrieval system