KEGG   Actinosynnema mirum: Amir_1003Help
Entry
Amir_1003         CDS       T00957                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ami  Actinosynnema mirum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Amir_1003
Enzymes [BR:ami01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Amir_1003
    3.5.1.-  
     Amir_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1118721..1119290)
Genome map
AA seq 189 aa AA seqDB search
MGRALIVVDVQNDFCEGGSLAVAGGAAVASAISAHVRGGGYDHVVATRDYHVDPGGHFSE
SPDYVDSWPVHCVAGTAGASFHPELDVTGVEAVFSKGAYEAAYSGFEGAAGDGASLVDWL
RERGVERVDVVGIATDHCVRATALDAAAAGFATRVLLGLTAGVARPTVDSALEQLRAAGV
ELDGEPAVG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagggcactgatcgtggtggacgtgcagaacgacttctgcgaggggggatcgctc
gcggtggcgggcggcgcggcggtggcctcggccatcagcgcgcacgtgcggggcggtggg
tacgaccacgtcgtggcgacgcgggactaccacgtcgaccccggcgggcacttcagcgag
tcgccggactacgtggactcgtggccggtgcactgcgtggccgggacggcgggggcctcg
ttccacccggagctggacgtgaccggggtggaggcggtgttctccaagggcgcgtacgag
gcggcgtactcggggttcgagggcgcggcaggcgacggggcgtccctggtggactggttg
cgcgagcgcggcgtcgagcgggtggacgtggtggggatcgccacggaccactgcgtgcgg
gcgacggcgctggacgcggcggcggccgggttcgccacgcgggtgctgctcgggctgacc
gccggggtggcgcggccgaccgtggactcggcgctggagcagctgcgggccgccggggtc
gagctggacggggagcccgcggtcggctga

DBGET integrated database retrieval system