KEGG   Actinosynnema mirum: Amir_1205Help
Entry
Amir_1205         CDS       T00957                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ami  Actinosynnema mirum
Pathway
ami00260  Glycine, serine and threonine metabolism
ami00750  Vitamin B6 metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01230  Biosynthesis of amino acids
Module
ami_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amir_1205
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Amir_1205
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Amir_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACU35157
JGI: Amir_1205
UniProt: C6WRA5
Position
complement(1348001..1349266)
Genome map
AA seq 421 aa AA seqDB search
MTAVSSAPSTSTSFDLGPARALSCRECGHETPLAPEYACQECFGPLEVAYDFGRVRREDI
EAGPRSIWRYKGLLPVPSTVSAHPNTEPGGTRLIQADNLAKALGVRKLWVKDDTGNPTHS
FKDRVVGVALAAARELGFRVLACPSTGNLANAVAAAAARAGWQSVVLVPSSLERAKILMS
AVYDGSLITIDGTYDDVNRVAQELAAENEDWAFVNVNVRPYYAEGSKTLGYEVAEQLGWR
LPEQIVIPIASGSQLTKVDKAFREFGSLGLVDETPYRVFGAQATGCSPVSTAFKAGHDTV
VPVRPDTIARSLAIGAPADGPYALDSVRRTGGAIEDVTDEEVVEGIRLLARTEGVFAETA
GGVTVATAKKLIESGKLDPDAETVLLITGDGLKTLDALGDRVGPRATVAASADAVINALK
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgtcagcagcgcaccctcgaccagcacctccttcgacctcggccccgctcgg
gcgctgtcctgtcgggagtgcggccacgagaccccgctcgcccccgagtacgcctgccag
gagtgcttcggccccctggaagtggcctacgacttcggccgcgtccggcgcgaggacatc
gaagcgggcccccgctccatctggcgctacaagggcctcctccccgtcccgtcgaccgtc
tccgcccaccccaacaccgagcccggcggcacccgcctcatccaggcggacaacctggcc
aaggcgctgggcgtgcgcaagctgtgggtcaaggacgacaccggcaaccccacccactcg
ttcaaggaccgcgtcgtcggcgtcgcgctggccgccgcccgcgaactgggcttccgcgtg
ctggcctgcccgtccaccggcaacctcgccaacgccgtcgccgcagccgccgcgcgcgcc
ggctggcagtcggtcgtgctcgtcccctcctccctggagcgggccaagatcctcatgtcc
gccgtgtacgacggctcgctgatcaccatcgacggcacctacgacgacgtcaaccgggtc
gcccaggagctcgccgccgagaacgaggactgggcgttcgtcaacgtcaacgtgcgcccg
tactacgccgagggctccaagaccctcggctacgaggtcgccgagcagctcggctggcgc
ctgcccgagcagatcgtcatccccatcgcctccggctcgcagctcaccaaggtcgacaag
gcgttccgcgagttcggctccctcggcctggtcgacgagaccccgtaccgcgtcttcggc
gcgcaggccaccggctgctcccccgtctcgaccgccttcaaggcgggccacgacacggtc
gtcccggtccgcccggacaccatcgcccgctcgctggcgatcggcgccccggccgacggc
ccgtacgccctggacagcgtccgccgcaccggcggcgccatcgaggacgtcaccgacgag
gaggtcgtcgagggcatccgcctgctggcccgcaccgagggcgtcttcgccgagacggcg
ggcggcgtgaccgtcgcgaccgcgaagaagctcatcgagtcgggcaagctcgaccccgac
gccgagaccgtcctgctgatcaccggcgacggcctgaagaccctcgacgccctcggcgac
cgcgtgggcccgcgcgccaccgtcgcagcgagcgccgacgcggtcatcaacgcactcaag
gactga

DBGET integrated database retrieval system