KEGG   Actinosynnema mirum: Amir_1205Help
Entry
Amir_1205         CDS       T00957                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ami  Actinosynnema mirum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amir_1205
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amir_1205
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Amir_1205
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Amir_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1348001..1349266)
Genome map
AA seq 421 aa AA seqDB search
MTAVSSAPSTSTSFDLGPARALSCRECGHETPLAPEYACQECFGPLEVAYDFGRVRREDI
EAGPRSIWRYKGLLPVPSTVSAHPNTEPGGTRLIQADNLAKALGVRKLWVKDDTGNPTHS
FKDRVVGVALAAARELGFRVLACPSTGNLANAVAAAAARAGWQSVVLVPSSLERAKILMS
AVYDGSLITIDGTYDDVNRVAQELAAENEDWAFVNVNVRPYYAEGSKTLGYEVAEQLGWR
LPEQIVIPIASGSQLTKVDKAFREFGSLGLVDETPYRVFGAQATGCSPVSTAFKAGHDTV
VPVRPDTIARSLAIGAPADGPYALDSVRRTGGAIEDVTDEEVVEGIRLLARTEGVFAETA
GGVTVATAKKLIESGKLDPDAETVLLITGDGLKTLDALGDRVGPRATVAASADAVINALK
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgtcagcagcgcaccctcgaccagcacctccttcgacctcggccccgctcgg
gcgctgtcctgtcgggagtgcggccacgagaccccgctcgcccccgagtacgcctgccag
gagtgcttcggccccctggaagtggcctacgacttcggccgcgtccggcgcgaggacatc
gaagcgggcccccgctccatctggcgctacaagggcctcctccccgtcccgtcgaccgtc
tccgcccaccccaacaccgagcccggcggcacccgcctcatccaggcggacaacctggcc
aaggcgctgggcgtgcgcaagctgtgggtcaaggacgacaccggcaaccccacccactcg
ttcaaggaccgcgtcgtcggcgtcgcgctggccgccgcccgcgaactgggcttccgcgtg
ctggcctgcccgtccaccggcaacctcgccaacgccgtcgccgcagccgccgcgcgcgcc
ggctggcagtcggtcgtgctcgtcccctcctccctggagcgggccaagatcctcatgtcc
gccgtgtacgacggctcgctgatcaccatcgacggcacctacgacgacgtcaaccgggtc
gcccaggagctcgccgccgagaacgaggactgggcgttcgtcaacgtcaacgtgcgcccg
tactacgccgagggctccaagaccctcggctacgaggtcgccgagcagctcggctggcgc
ctgcccgagcagatcgtcatccccatcgcctccggctcgcagctcaccaaggtcgacaag
gcgttccgcgagttcggctccctcggcctggtcgacgagaccccgtaccgcgtcttcggc
gcgcaggccaccggctgctcccccgtctcgaccgccttcaaggcgggccacgacacggtc
gtcccggtccgcccggacaccatcgcccgctcgctggcgatcggcgccccggccgacggc
ccgtacgccctggacagcgtccgccgcaccggcggcgccatcgaggacgtcaccgacgag
gaggtcgtcgagggcatccgcctgctggcccgcaccgagggcgtcttcgccgagacggcg
ggcggcgtgaccgtcgcgaccgcgaagaagctcatcgagtcgggcaagctcgaccccgac
gccgagaccgtcctgctgatcaccggcgacggcctgaagaccctcgacgccctcggcgac
cgcgtgggcccgcgcgccaccgtcgcagcgagcgccgacgcggtcatcaacgcactcaag
gactga

DBGET integrated database retrieval system