KEGG   Actinosynnema mirum: Amir_1350Help
Entry
Amir_1350         CDS       T00957                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ami  Actinosynnema mirum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_1350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amir_1350
  Amino acid metabolism
   00310 Lysine degradation
    Amir_1350
Enzymes [BR:ami01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Amir_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1491949..1493670)
Genome map
AA seq 573 aa AA seqDB search
MAISVPMPALGESVTEGTVTRWLKQEGDRVEVDEPLLEVSTDKVDTEIPSPAAGVLQKIV
AQEDETVEVGAELAVIGDGSDNDAASAPADSAPAPAAPAEEAQPEPQSDPEPETEAAPSG
GSADGTPVTMPALGESVTEGTVTRWLKQVGDSVEVDEPLLEVSTDKVDTEIPSPVAGTLL
EITAGEDETVEVGGKLAVIGSGAPAKQEAPKAAPAPEAPKQEAPKAEAPKQEAPKAEAPK
QEAPKQEAPKQAAPAAEKSGDEGAPYVTPLVRKLASENGIDLGSLKGTGVGGRIRKQDVL
AAVEAKKAPAAAPAAAAAPAAPAAKSAPVDTSGKRGTTQKLPRLRQIVAQRTRESLQMSA
QLTQVFEVDVTRIARLRSRAKSAFEQREGTKLTFLPFFAKAAVEALKQHPVLNASIDEAK
KEVTYHGSEHLGIAIDTERGLLNAVISNAGELNLAGLSLKINDLAGRARGNKLTPDELTG
GTFSLTNLGSNGALFDTPIIQQPQVGILGVGVVKKRPVVITDANGDDTIAIRSMAYLALT
YDHRLVDGADAGRFLSTMKNRLEEGAFEGDLGL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttccgatgcccgcactcggtgaaagcgtcaccgagggcacggtcacc
cgctggttgaagcaggagggcgaccgggtcgaggtcgacgagccgttgctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgcccgccgcgggcgtcctgcagaagatcgtc
gcccaggaggacgagaccgtcgaggtcggcgccgagctggcggtgatcggcgacggttcc
gacaacgacgcggccagcgctccggccgactcggctcccgcgcccgccgcgcccgccgag
gaggctcagcccgagccgcagtccgaccccgagcccgagaccgaggccgccccgtccggc
ggcagcgccgacggcaccccggtgaccatgcccgcgctgggcgagagcgtcaccgagggc
accgtgacccgctggctcaagcaggtcggcgactcggtggaggtcgacgagcccctgctg
gaggtctcgaccgacaaggtcgacaccgagatcccgtccccggtggcgggcacgctgctg
gagatcaccgcgggcgaggacgagacggtcgaggtcggcggcaagctggccgtgatcggc
tcgggcgcgcccgcgaagcaggaggccccgaaggccgctccggctcccgaggcccccaag
caggaggctcccaaggccgaggcgcccaagcaggaggcccccaaggccgaggcccccaag
caggaggccccgaagcaggaggctcccaagcaggccgctccggccgccgagaagtccggt
gacgagggcgcgccctacgtcaccccgctggtgcgcaagctggcctcggagaacggcatc
gacctcggttccctgaagggcaccggcgtcggcggtcgcatccgcaagcaggacgtgctg
gccgccgtcgaggccaagaaggccccggccgccgcgcccgccgccgctgccgccccggcc
gcgcccgccgccaagtccgcgcccgtggacaccagcggcaagcgcggcaccacgcagaag
ctcccccgcctgcgccagatcgtggcccagcggacccgcgagtcgctgcagatgtcggcc
cagctcacccaggtgttcgaggtggacgtcacccggatcgcgcgcctgcgcagccgggcg
aagtccgcgttcgagcagcgcgagggcacgaagctcacgttcctcccgttcttcgccaag
gcggcggtcgaggccctgaagcagcacccggtgctgaacgcctccatcgacgaggcgaag
aaggaggtcacgtaccacggctccgagcacctcggcatcgcgatcgacaccgagcgcggc
ctgctcaacgcggtgatctcgaacgcgggcgagctgaacctggccggcctgtcgctcaag
atcaacgacctggccggtcgggcgcgcgggaacaagctgaccccggacgagctgaccggc
ggcacgttctcgctgaccaacctgggcagcaacggcgccctcttcgacaccccgatcatc
cagcagccgcaggtcggcatcctgggcgtcggcgtggtcaagaagcgccccgtggtgatc
accgacgccaacggcgacgacacgatcgcgatccggtccatggcctacctggccctgacc
tacgaccaccgcctggtggacggcgcggacgccggtcgcttcctgagcaccatgaagaac
cgcctggaggaaggcgccttcgagggcgacctcggcctctga

DBGET integrated database retrieval system