KEGG   Actinosynnema mirum: Amir_1389Help
Entry
Amir_1389         CDS       T00957                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ami  Actinosynnema mirum
Pathway
ami00010  Glycolysis / Gluconeogenesis
ami00052  Galactose metabolism
ami00500  Starch and sucrose metabolism
ami00520  Amino sugar and nucleotide sugar metabolism
ami00521  Streptomycin biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_1389
   00052 Galactose metabolism
    Amir_1389
   00500 Starch and sucrose metabolism
    Amir_1389
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_1389
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amir_1389
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Amir_1389
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Amir_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Pan_kinase FGGY_N TCR Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACU35341
JGI: Amir_1389
UniProt: C6W9H8
Position
1532075..1533052
Genome map
AA seq 325 aa AA seqDB search
MLTIGIDVGGTSVRAGVVDADGAVLDTTRTATPGDERALEEAIGGAVHELAERHEVAAVG
LAVAGFVASDRRTVMFAPHLAWRHAPVAERISERVGMPVVLEHDANAAALAEHRFGAARG
AGVAVLVAVGTGIGGALLIDGEVFRGAHGVAPELGHLRLVPDGRPCPCGKSGCWERYCSG
TALSSTAVELLAKHPGVSTVLAREARGDARAITGRRVAGAARDGDPLAQRAVADLARWLG
EGLALVADVYDPEVVVVGGGVSESATLFLDDAREHYASVVTGAGHRPLARIRTAQLGDDA
GLVGVATLARDLAVGATQSPGGRLG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacgatcgggatcgacgtcggcgggacgagcgtgcgggccggggtcgtggacgcg
gacggcgcggtgctcgacaccacgcgcaccgcaacgcccggcgacgagcgggcgctggag
gaggccatcggcggggcggtgcacgagctggccgagcggcacgaggtcgccgcggtcggg
ctcgcggtcgccgggttcgtggcctcggaccggcgcacggtgatgttcgcgccgcacctg
gcgtggcggcacgcgcccgtggccgagcggatctcggagcgggtcgggatgccggtcgtg
ctggagcacgacgcgaacgcggcggcgctggccgagcaccggttcggcgcggcgcgcggc
gcgggcgtcgcggtgctggtcgccgtgggcaccggcatcggcggggcgctgctgatcgac
ggcgaggtgttccggggcgcccacggcgtggcccccgagctggggcacctgcggctggtc
ccggacggcaggccgtgcccgtgcggcaagagcgggtgctgggagcggtactgcagcggc
accgcgctgagctcgaccgccgtggagctgctcgcgaagcaccccggcgtgtcgacggtg
ctggcgcgggaggcgcgcggggacgcgcgggcgatcaccgggaggcgggtggcgggcgcg
gcccgcgacggcgacccgctggcgcagcgcgcggtcgccgacctggccaggtggctgggg
gaggggttggcgctggtcgcggacgtgtacgacccggaggtggtcgtggtcgggggcggc
gtgtccgagtctgcgaccctgttcctggacgacgcgcgcgagcactacgcgtccgtggtg
accggcgcgggccaccgccccctggcccgcatccggaccgcgcagctgggcgacgacgcc
gggctggtcggggtcgcgaccctggccagggacctggcggtgggcgcgacgcagtcgccc
ggagggcggctgggctga

DBGET integrated database retrieval system