KEGG   Actinosynnema mirum: Amir_1510Help
Entry
Amir_1510         CDS       T00957                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
ami  Actinosynnema mirum
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ami01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ami00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ami00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1668710..1669471)
Genome map
AA seq 253 aa AA seqDB search
MVMTRGFGVDIGGSGIKGGLVDLEMGALDGERLRIATPQPSTPDAVADVVAEIVEKFGWD
GPVGITLPCVVKRGVALSAANVDKGWIDTDAQALFARRLGRAADQVVVLNDADAAGVAEM
EFGAGVGKDGLVVLLTFGTGIGSAVFLDGKLVPNTEFGHLEVDGHDAEKRAAASVKEDKG
LSWAEWAPRVSRYVTVLENLIWPDLVIAGGGVSKKAEKWLPLLEVRTPVVAAALKNDAGI
VGAAVAATRGFQH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgacccgcgggttcggcgtggacatcggcggctcgggcatcaagggcggtctg
gtggacctggagatgggcgcgctggacggtgagcggctgcgcatcgccacgccgcagccg
tccacgccggacgcggtagccgacgtggtcgcggagatcgtggagaagttcggctgggac
ggcccggtcggcatcaccctcccgtgcgtggtcaagcgcggtgtcgcgctgtccgcggcc
aacgtcgacaagggctggatcgacaccgacgcgcaggcgctgttcgcgcgcaggctcggt
cgggccgccgaccaggtggtggtgctcaacgacgcggacgcggcgggcgtcgccgagatg
gagttcggcgcgggggtgggcaaggacggcctggtcgtgctgctgaccttcggcaccggc
atcggcagcgccgtgttcctggacggcaagctcgtccccaacaccgagttcggccacctg
gaggtggacgggcacgacgcggagaagcgcgccgcggcctcggtgaaggaggacaagggg
ctgtcctgggccgagtgggcgcccagggtctcccggtacgtcaccgtgctggagaacctg
atctggcccgacctggtcatcgcgggcggcggggtgagcaagaaggcggagaagtggctc
cccctgctggaggtccgcaccccggtcgtggccgccgcgctgaagaacgacgcgggcatc
gtcggggcggcggtggccgccaccaggggcttccagcactga

DBGET integrated database retrieval system