KEGG   Actinosynnema mirum: Amir_1510Help
Entry
Amir_1510         CDS       T00957                                 

Definition
polyphosphate--glucose phosphotransferase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
ami  Actinosynnema mirum
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_1510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_1510
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_1510
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Amir_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1668710..1669471)
Genome map
AA seq 253 aa AA seqDB search
MVMTRGFGVDIGGSGIKGGLVDLEMGALDGERLRIATPQPSTPDAVADVVAEIVEKFGWD
GPVGITLPCVVKRGVALSAANVDKGWIDTDAQALFARRLGRAADQVVVLNDADAAGVAEM
EFGAGVGKDGLVVLLTFGTGIGSAVFLDGKLVPNTEFGHLEVDGHDAEKRAAASVKEDKG
LSWAEWAPRVSRYVTVLENLIWPDLVIAGGGVSKKAEKWLPLLEVRTPVVAAALKNDAGI
VGAAVAATRGFQH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgacccgcgggttcggcgtggacatcggcggctcgggcatcaagggcggtctg
gtggacctggagatgggcgcgctggacggtgagcggctgcgcatcgccacgccgcagccg
tccacgccggacgcggtagccgacgtggtcgcggagatcgtggagaagttcggctgggac
ggcccggtcggcatcaccctcccgtgcgtggtcaagcgcggtgtcgcgctgtccgcggcc
aacgtcgacaagggctggatcgacaccgacgcgcaggcgctgttcgcgcgcaggctcggt
cgggccgccgaccaggtggtggtgctcaacgacgcggacgcggcgggcgtcgccgagatg
gagttcggcgcgggggtgggcaaggacggcctggtcgtgctgctgaccttcggcaccggc
atcggcagcgccgtgttcctggacggcaagctcgtccccaacaccgagttcggccacctg
gaggtggacgggcacgacgcggagaagcgcgccgcggcctcggtgaaggaggacaagggg
ctgtcctgggccgagtgggcgcccagggtctcccggtacgtcaccgtgctggagaacctg
atctggcccgacctggtcatcgcgggcggcggggtgagcaagaaggcggagaagtggctc
cccctgctggaggtccgcaccccggtcgtggccgccgcgctgaagaacgacgcgggcatc
gtcggggcggcggtggccgccaccaggggcttccagcactga

DBGET integrated database retrieval system