KEGG   Actinosynnema mirum: Amir_1665Help
Entry
Amir_1665         CDS       T00957                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ami  Actinosynnema mirum
Pathway
ami00052  Galactose metabolism
ami00561  Glycerolipid metabolism
ami00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amir_1665
  Lipid metabolism
   00561 Glycerolipid metabolism
    Amir_1665
   00600 Sphingolipid metabolism
    Amir_1665
Enzymes [BR:ami01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Amir_1665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 Ricin_B_lectin RicinB_lectin_2 Melibiase
Motif
Other DBs
NCBI-ProteinID: ACU35614
JGI: Amir_1665
UniProt: C6WBP6
Position
complement(1817991..1819694)
Genome map
AA seq 567 aa AA seqDB search
MHRARTLITGAVLALLAAGVAVPFPASAAPSTGQAQPRRTEPAQPQPAQPQPAQPATGFD
GAAIPRDPVVPMLDDGASRVPPMGFNNWNSFGCDVTEELIMATADIFVTSGLKDAGYQYV
NIDDCWSTRERDADGNLVPDPVKFPKGIKHVADYVHSRGLLLGLYGDAGTLTCAGYPGSL
GHEQRDAAAFASWGVDYLKYDNCYNQGIDARQRYTTMRDALLATGRRIVFSVCEWGENQP
WTWARDVGHLWRTTPDITDTWGSVVDIFHRNAPLNDAAGPGGWNDPDMLEVGNGGMTTTE
YRSHFTLWAQMAAPLLIGADLRVATPETMAIYLNRGLIAVNQDPLGVQARPVSSSGARHV
LSKPLANGDRSVVLFNEGGAEAVVGTSLQAIGLPGGGSTATDLWTGATRRFTGAITARVP
AHGVVAMRIRADAAPPAGATNLVGGSSGRCLDLPGGRTGVQVALWDCNGGPNQQFRHTAS
GELRVQGEHCLEAFANGVAEGTQVVTWQCNGGANQRWTRQASGQLVNAGSGLCLDVTAGH
LPENNLNGSPIALWQCNSGPNQRWSRQ
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgagcgcgcactctgatcaccggggccgtcctggccctgctggccgccggggtg
gcggtcccgttcccggcctcggccgcaccctcgaccggccaggcgcagccccggcggacc
gagcccgcccagccccaacccgcccagccccaacccgcccagcccgccaccgggttcgac
ggcgcggccatcccgcgcgacccggtcgtcccgatgctcgacgacggcgcgtcgcgcgtc
ccgccgatggggttcaacaactggaactccttcggctgcgacgtcaccgaagagctgatc
atggccaccgccgacatcttcgtgacctccggtctgaaggacgccggctaccagtacgtc
aacatcgacgactgctggtccacgcgcgagcgcgacgcggacggcaacctggtgcccgac
ccggtcaagttccccaagggcatcaagcacgtcgccgactacgtgcactccaggggcctg
ctcctgggcctgtacggcgacgcgggcacgctcacctgcgcgggctaccccggcagcctc
ggccacgagcagcgcgacgcggcggccttcgcgtcgtggggcgtggactacctgaagtac
gacaactgctacaaccagggcatcgacgcccgccagcgctacacgaccatgcgggacgcg
ctgctggccaccggcaggcggatcgtgttcagcgtctgcgagtggggcgagaaccagccg
tggacgtgggcccgcgacgtcggccacctgtggcgcaccaccccggacatcaccgacacc
tggggcagcgtcgtggacatcttccaccgcaacgccccgctcaacgacgcggcgggcccc
ggcggctggaacgacccggacatgctggaggtcggcaacggcggcatgaccaccaccgag
taccgcagccacttcacgctgtgggcgcagatggcggccccgctgctgatcggcgcggac
ctgcgggtggccacgccggagaccatggcgatctacctcaaccgggggctgatcgcggtc
aaccaggacccgctgggcgtgcaggcgcggccggtgtcctcgtccggggcgcggcacgtg
ctgagcaagccgctggcgaacggcgaccggtcggtggtgctgttcaacgagggcggcgcc
gaggcggtggtcggcacgtcgctgcaggcgatcgggctgcccggcggcgggtcgaccgcg
acggacctgtggaccggggcgacgcggcggttcaccggggcgatcaccgcgcgggtgccc
gcgcacggcgtggtggcgatgcggatcagggcggacgcggcgcccccggcgggcgcgacg
aacctggtcggcgggtcgtcggggcgctgcctggacctgccgggcggccggaccggggtg
caggtcgcgctgtgggactgcaacggcgggccgaaccagcagttccggcacaccgcgtcg
ggcgagctgcgggtgcagggcgagcactgcctcgaggcgttcgcgaacggcgtggccgag
ggcacgcaggtggtgacgtggcagtgcaacggcggggcgaaccagcggtggacgcggcag
gcgtccgggcagctggtgaacgccgggagcgggctgtgcctggacgtgacggccgggcac
cttccggagaacaacctgaacgggtcgccgatcgcgctgtggcagtgcaacagcggcccg
aaccagcggtggtcgcggcagtag

DBGET integrated database retrieval system