KEGG   Actinosynnema mirum: Amir_1732Help
Entry
Amir_1732         CDS       T00957                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ami  Actinosynnema mirum
Pathway
ami00521  Streptomycin biosynthesis
ami00523  Polyketide sugar unit biosynthesis
ami01130  Biosynthesis of antibiotics
Module
ami_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Amir_1732
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amir_1732
Enzymes [BR:ami01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Amir_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Peptidase_S9_N
Motif
Other DBs
NCBI-ProteinID: ACU35680
JGI: Amir_1732
UniProt: C6WCR3
Position
1896367..1896969
Genome map
AA seq 200 aa AA seqDB search
MSGVVTPKQGMDMTVTPTEIDGVRVVQPEWFEDERGFFFESYSKRRWEQHGLHLDFVQDN
HSRSSRGVLRGLHFQTGLAPQHRLVRCTVGAIWDVVVDIRVGSPTFGKWFGIELSATNRT
QLLMGPGFAHGFAVLSDVAEVQYKTTGFHTPEAEGLLAWDDPDVGIPWPIEDPTLSAKDS
ANPSLAAYRENPAFHHGVEA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggtggtcacccccaagcagggcatggacatgacggtcacgccgacggagatc
gacggcgtgcgcgtggtccagcccgagtggttcgaggacgagcgcggcttcttcttcgag
tcctacagcaagcgccgctgggagcagcacgggctgcacctggacttcgtgcaggacaac
cactcccggtccagcaggggggtgctgcgcgggctgcacttccagaccggactcgccccg
cagcaccggctggtgcgctgcaccgtcggcgccatctgggacgtggtggtcgacatccgg
gtcggctcgccgaccttcggcaagtggttcgggatcgagctgtccgcgaccaaccgcacc
cagctgctgatggggccgggcttcgcgcacggcttcgcggtgctgtccgacgtcgccgag
gtccagtacaagaccaccggcttccacacccccgaggccgagggcctgctggcctgggac
gacccggacgtgggcatcccgtggccgatcgaggacccgacgctgtccgcgaaggactcg
gccaacccgagcctcgccgcctaccgggagaacccggccttccaccacggagttgaagcg
tga

DBGET integrated database retrieval system