KEGG   Actinosynnema mirum: Amir_1732Help
Entry
Amir_1732         CDS       T00957                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ami  Actinosynnema mirum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Amir_1732
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Amir_1732
Enzymes [BR:ami01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Amir_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1896367..1896969
Genome map
AA seq 200 aa AA seqDB search
MSGVVTPKQGMDMTVTPTEIDGVRVVQPEWFEDERGFFFESYSKRRWEQHGLHLDFVQDN
HSRSSRGVLRGLHFQTGLAPQHRLVRCTVGAIWDVVVDIRVGSPTFGKWFGIELSATNRT
QLLMGPGFAHGFAVLSDVAEVQYKTTGFHTPEAEGLLAWDDPDVGIPWPIEDPTLSAKDS
ANPSLAAYRENPAFHHGVEA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggtggtcacccccaagcagggcatggacatgacggtcacgccgacggagatc
gacggcgtgcgcgtggtccagcccgagtggttcgaggacgagcgcggcttcttcttcgag
tcctacagcaagcgccgctgggagcagcacgggctgcacctggacttcgtgcaggacaac
cactcccggtccagcaggggggtgctgcgcgggctgcacttccagaccggactcgccccg
cagcaccggctggtgcgctgcaccgtcggcgccatctgggacgtggtggtcgacatccgg
gtcggctcgccgaccttcggcaagtggttcgggatcgagctgtccgcgaccaaccgcacc
cagctgctgatggggccgggcttcgcgcacggcttcgcggtgctgtccgacgtcgccgag
gtccagtacaagaccaccggcttccacacccccgaggccgagggcctgctggcctgggac
gacccggacgtgggcatcccgtggccgatcgaggacccgacgctgtccgcgaaggactcg
gccaacccgagcctcgccgcctaccgggagaacccggccttccaccacggagttgaagcg
tga

DBGET integrated database retrieval system