KEGG   Actinosynnema mirum: Amir_1795Help
Entry
Amir_1795         CDS       T00957                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ami  Actinosynnema mirum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Amir_1795
   00051 Fructose and mannose metabolism
    Amir_1795
Enzymes [BR:ami01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Amir_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1976134..1977273
Genome map
AA seq 379 aa AA seqDB search
MTDFSFGLWTVGWQGRDPFGDATRPVLDAPTAVRKLAELGAWGVTFHDDDLIPFGAGAAE
RDRRVSAFRGALDETGLVVPMVTTNLFTHPVFKDGGFTSNDRSVRRFALRKVLRNLELAA
ELGAKTIVLWGGREGSETDAGKDVQAALERYREALDTVAQHSVDQGYGFRFALEPKPNEP
RGDILLPTVGHALAFISTLQHHELVGVNPEVGHEQMANLNFVHGIAQALWQKKLFHIDLN
GQKGPRFDQDLVFGHGDLLSAFFLVDLLENGGYDGPRHFDYKPLRTEDVDGVWDSAAANM
RTYTLLKERAQAYRADPEVQEALRVSGVTEQAVPTLGEGESIADFLAADESFDPDKAAER
GYGFVKLSQLALEHLLGAR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacttcagcttcggcctgtggacggttggctggcaggggcgtgacccgttcggg
gacgccacccggcccgtcctcgacgcgccaacggcggtgcgcaagctcgccgagctgggc
gcctggggcgtcaccttccacgacgacgacctgatccccttcggggccggcgccgccgag
cgggaccggcgggtctccgcgttccgcggcgcgctcgacgagaccgggctcgtcgtgccg
atggtgaccacgaacctgttcacccaccccgtcttcaaggacggcggcttcaccagcaac
gaccggtcggtgcgccggttcgcgctgcgcaaggtgctgcgcaacctggagctcgccgcc
gagctcggcgccaagacgatcgtcctgtggggcggtcgcgagggctccgagacggacgcg
ggcaaggacgtgcaggccgccctggagcggtaccgcgaggcgctggacacggtcgcgcag
cactccgtcgaccagggctacggcttccggttcgcgctggagcccaagcccaacgagccg
cgcggcgacatcctgctgccgaccgtcgggcacgcgctcgcgttcatctccaccctccag
caccacgagctggtcggcgtgaaccccgaggtcggccacgagcagatggccaacctgaac
ttcgtccacggcatcgcgcaggcgctgtggcagaagaagctgttccacatcgacctcaac
gggcagaaggggccgcgcttcgaccaggacctggtcttcggccacggcgacctgctctcg
gcgttcttcctggtcgacctcctggagaacggcggctacgacggcccccgccacttcgac
tacaagccgctgcgcaccgaggacgtcgacggcgtgtgggacagcgccgccgccaacatg
cgcacctacaccctcctcaaggagcgcgcgcaggcctaccgcgccgaccccgaggtgcag
gaggcgctgcgggtcagcggcgtcaccgagcaggccgtgcccaccctcggcgagggcgag
tcgatcgcggacttcctcgcggccgacgagtcgttcgaccccgacaaggccgccgagcgc
gggtacgggttcgtgaagctgtcgcagctggccctcgagcacctcctgggcgcccgctga

DBGET integrated database retrieval system