KEGG   Actinosynnema mirum: Amir_1840Help
Entry
Amir_1840         CDS       T00957                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ami  Actinosynnema mirum
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ami00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ami00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ami02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2023192..2025039
Genome map
AA seq 615 aa AA seqDB search
MGGVLKRTRKLAVTGTALGVAFASVPVGVASAAETTAPKNVIVLISDGAGYNQFDAASLY
EHGQSLNQVAVDPATGAVQRVPGVPSQVYEHFPVKVSQSHYSANGRAAYTPEQAWGSFDW
VASGATDSAAAATALGTGVKTNNGVIGFDPAGQKLLTVGEQAKKVGKKVGVVTSVPFNHA
TPAGFIAHNADRNDYQGLATEMIDSGADVIMGGGHPNYTDAHTSRASNWTWISQNDFQRV
STGGTDFSYVETRSGFEALATATEVPEKVFGLAQVAETLQYNRPGLGNTRVKPGTDARND
VASLDVMAKGALNVLEKDEDGFFLMVEGGAVDWAGHANQTTRLVEEQVEFNRSVEAVTDW
VERNSSWDETLVVVTADHETGYLAGPGSKPTWTPMTGAKGELPQVSWHSGGHTNALVPFY
AKGAGSDVLNARADKWDTVRGAYLDNTAVGETVFDLLGHAPASADSAVALEASVPLPSTA
GDLSMTVADSGAVRFTGERTRTGALPQVTVTDTRNEVQARGQGWTVSGAAGEFVAGNRKF
GAENLGWTPKVVSSDSNAAAGPQAVLDAPAALADTNRVSRYGTTVVGADLGLTVPDEARS
GRYGSEITLTLFAKD
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggcggagtgctcaagcgcactcggaagctcgccgtcaccggcacggccctgggcgtc
gcgttcgcctcggtgcccgtcggtgtcgcgtcggccgcggagaccaccgcgccgaagaac
gtcatcgtgctcatctcggacggcgcgggctacaaccagttcgacgccgccagcctgtac
gagcacgggcagagcctcaaccaggtcgcggtggaccccgcgaccggagccgtgcagcgc
gtccccggcgtgcccagccaggtctacgagcacttccccgtgaaggtctcgcagagccac
tactcggcgaacgggcgcgccgcctacacccccgagcaggcctggggctcgttcgactgg
gtcgcctccggcgcgaccgactccgccgccgcggccaccgcgctcggcaccggcgtcaag
accaacaacggcgtcatcggcttcgacccggcggggcagaagctgctgaccgtgggcgag
caggccaagaaggtcggcaagaaggtcggcgtcgtcacctcggtgccgttcaaccacgcc
accccggcgggcttcatcgcccacaacgccgaccgcaacgactaccagggcctcgcgacc
gagatgatcgacagcggcgccgacgtcatcatgggcggcgggcacccgaactacaccgac
gcgcacaccagccgcgcgtccaactggacctggatctcgcagaacgacttccagcgcgtc
agcaccggtggcaccgacttctcctacgtcgagacccgctccggtttcgaggcgctggcc
accgcgaccgaggtcccggagaaggtcttcggcctggcgcaggtcgccgagaccctccag
tacaaccggccgggcctgggcaacaccagggtcaagcccggtaccgacgcccgcaacgac
gtcgcgtcgctcgacgtgatggccaagggcgcgctgaacgtcctggagaaggacgaggac
ggcttcttcctcatggtcgagggcggcgccgtcgactgggcaggccacgccaaccagacc
acgcgcctggtggaggagcaggtcgagttcaaccgctccgtcgaggccgtcaccgactgg
gtcgagcgcaacagcagctgggacgagaccctggtcgtcgtcaccgccgaccacgagacc
ggctacctcgcgggccccggctccaagccgacctggaccccgatgaccggggccaagggc
gagctgccccaggtgtcgtggcactccggtggccacaccaacgcgctggttcccttctac
gccaagggcgccggctcggacgtgctgaacgcgcgcgccgacaagtgggacaccgtgcgc
ggcgcgtacctggacaacaccgccgtcggcgagaccgtgttcgacctgctgggccacgcc
ccggcctcggccgactcggccgtcgcgctggaggcatccgtgccgctgcccagcaccgcc
ggtgacctgagcatgaccgtcgccgacagcggcgccgtccggttcaccggcgagcgcacc
cggaccggcgcgctgccgcaggtcaccgtgaccgacacccgcaacgaggtgcaggcgcgc
ggccagggctggaccgtctccggcgccgccggtgagttcgtggcgggcaaccggaagttc
ggcgccgagaacctgggctggaccccgaaggtcgtcagctccgactcgaacgccgccgcc
ggtccgcaggccgtcctggacgcgcccgccgcgctggccgacaccaaccgcgtcagccgc
tacggcaccaccgtcgtgggcgccgacctcggcctgaccgtgccggacgaggcccgcagc
ggtcgctacggcagcgagatcaccctgacgctgttcgccaaggactga

DBGET integrated database retrieval system