KEGG   Actinosynnema mirum: Amir_1896Help
Entry
Amir_1896         CDS       T00957                                 

Definition
XRE family transcriptional regulator
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ami  Actinosynnema mirum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ami00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ami00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2106355..2107893)
Genome map
AA seq 512 aa AA seqDB search
MTKDLDRDYLTRVGGLIRASRRQRGWSQAQLATAVSTSQSAINRIEQGGQNLSLEMLSRI
SEALDSGIVSIGQPAPTHLRVTGGRRLSGTISVKTSKNAGVALLCASLLNSGRTVLRKLA
RIEEVNRILEVLGSIGVRTRWLNDDNDLEIIPPKRLDLAGINVDAARRTRSIIMLLGPLL
HHEERFELPYAGGCALGSRTVEPHMVALRPFGLEVKAAAGSYHAEVDRTAPKRPIVLTER
GDTVTENALMAAARHEGTTVIRNASPNYMVQDLCFFLTELGVRIEGVGTTTLTVHGVGAV
DQDIDYAPSEDPIEAMSLISAAIVTSSEITIQRVPIEFLEIELALLEEMGLDYDRTDEYP
AANGRTRLVDLVVRPSALHAPIDKIHPMPFPGLNIDNLPFFALIAAVAQGSTLIHDWVYE
NRALYLTELTKLGAKVTLMDPHRVYVEGPTHWSGAEVICPPALRPAVVVLLAMLAAKGTS
VLRNVYVINRGYEQLAERLNQLGAEISTFRDI
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaggatcttgaccgcgactacctcacccgcgtcggcgggctcatccgcgcctcc
cgcaggcagcgcgggtggagccaggcccagctcgccaccgcggtgtcgaccagccagagc
gcgatcaaccgcatcgagcagggcggccagaacctgagcctggagatgctctcccggatc
agcgaggccctcgactccgggatcgtctccatcggtcagcccgcccccacccacctgcgg
gtgaccggcggccgtcgcctctccggcaccatcagcgtcaagaccagcaagaacgcgggc
gtcgccctgctctgcgcgtcgctgctgaactccggtcgcacggtcctgcgcaagctcgcc
cgcatcgaggaggtcaaccgcatcctcgaggtcctcggcagcatcggcgtccgcacccgc
tggctgaacgacgacaacgacctggagatcatcccgccgaagcggctggacctcgcgggc
atcaacgtcgacgcggcccgccgcacccgcagcatcatcatgctgctcggccccctcctg
caccacgaggagcgcttcgagctgccctacgcaggcggctgcgcgctcgggtcgcgcacg
gtcgagccgcacatggtggcgctgcgcccgttcgggctggaggtcaaggccgccgcgggc
agctaccacgccgaggtggaccgcaccgcccccaagcgcccgatcgtgctcaccgagcgg
ggtgacacggtgaccgagaacgcgctcatggcggcggcccgccacgagggcacgacggtc
atccgcaacgccagcccgaactacatggtccaggacctgtgcttcttcctgaccgagctg
ggcgtgcgcatcgagggcgtgggcaccacgacgctgaccgtgcacggcgtcggcgcggtc
gaccaggacatcgactacgccccctccgaggacccgatcgaggcgatgagcctgatctcc
gccgcgatcgtcacctcctccgagatcaccatccagcgcgtgccgatcgagttcctggag
atcgagctggcgctgctggaggagatgggcctggactacgaccgcaccgacgagtacccg
gccgccaacggccgcacccgcctggtcgacctggtcgtgcgcccgtccgcgctgcacgcg
cccatcgacaagatccacccgatgccgttccccggcctgaacatcgacaacctgccgttc
ttcgcgctgatcgcggccgtggcgcagggctcgaccctgatccacgactgggtgtacgag
aaccgcgcgctgtacctgaccgagctgaccaagctcggcgcgaaggtcaccctgatggac
ccgcaccgggtgtacgtcgagggccccacgcactggtccggcgccgaggtgatctgcccg
cccgcgctgcgcccggccgtcgtggtgctgctggcgatgctggccgcgaagggcacgtcg
gtgctgcgcaacgtgtacgtgatcaaccggggttacgagcagctggccgagcggctcaac
cagctgggcgcggagatcagcaccttccgcgacatctga

DBGET integrated database retrieval system