KEGG   Actinosynnema mirum: Amir_1918Help
Entry
Amir_1918         CDS       T00957                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ami  Actinosynnema mirum
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Amir_1918
Enzymes [BR:ami01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Amir_1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2125566..2127935
Genome map
AA seq 789 aa AA seqDB search
MSAQTGTTGADLKLIDAYWRAANYLSAGQIYLLDNPLLGTPLEAANIKPRLLGHWGTTPG
LNFVYAHLNRVIKQREAEVLFITGPGHGGPALLANTWLEGTYSETYAEVPQDARGMAKLF
RQFSFPGGVPSHVAPEVPGSIHEGGELGYSLAHAFGAAFDNPDLVVACVIGDGEAETGPL
AASWHANKFLNPAQDGAVLPILHLNGYKIANPALLARIPHEELDSLLRGYGYAPVYVEGH
EPEVMHAAMAEALDGVFDAIERIQARARSGEDTTRPAWPMIVLRSPKGWTGPSEVDGLQI
EGTWRAHQVPLSGVRDNPEHLRMLEQWLRSYRPEELFDANGAPVPELGELVPPGHLRMGA
TPHANGGTLLRDLRMPALSEHAVAVPEHGGSTSEPTRVLGRLLRDVVELNDAQRNFRLFG
PDETASNRLDAVYEVTGKQWQGETLPVDDHLVRAGRVVEVLSEHLCQGFLEGYLLTGRHG
LFNCYEAFTHIVDSMFNQHAKWLGTHRKLGWRRPIASLNYLLSSHVWRQDHNGFSHQDPG
FIDHVMNKKAEVVRVYLPPDTNTLLSVADHCLRSRDHVNVVVAGKNQTPDWLGPQEAALH
CARGLGIWEWAGNDDGVEEPDVVMACAGDAPTVEVMAAVSLLREHLPSLRVRVVNVVDLM
RLQPESEHPHGLSDHEFDAIFTTDRPVLFAYHGYPWLIHRLTYRRTNHNNIHVRGYKEEG
TTTTPFDMLVLNDMDRYRLVMDVIDRVPGLGPRTARLRQLMTDQRTRHNAWIREHGEDLP
EVRDWSWRS
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgcagaccggtacgaccggtgcagacctcaagctgatcgatgcttactggagg
gcggcgaactacctgtcagcggggcagatctacctgctggacaaccccctgctcggcacg
ccgctggaagcggcgaacatcaaaccgagactgctcgggcactggggcacgacccccggc
ctgaacttcgtctacgcgcacctcaaccgcgtcatcaagcagcgggaggccgaggtcctg
ttcatcaccggccccggtcacggcggtcccgcgctgctggccaacacctggctggagggc
acctacagcgagacctacgccgaggtgccgcaggacgcgcggggcatggcgaagctgttc
cggcagttctcgttccccggcggggtcccgagccacgtcgcgccggaggtccccggctcc
atccacgagggcggggagctgggctactcgctggcgcacgcgttcggcgcggccttcgac
aaccccgacctggtcgtcgcctgcgtcatcggcgacggcgaggccgagaccggcccgctg
gccgccagctggcacgccaacaagttcctgaacccggcgcaggacggcgcggtgctcccc
atcctgcacctcaacggctacaagatcgccaacccggcgctgctcgcccgcatcccgcac
gaggagctggacagcctcctgcgcggctacggctacgccccggtctacgtggagggccac
gagccggaggtcatgcacgccgcgatggccgaggcgctcgacggggtcttcgacgccatc
gagcggatccaggcgcgcgcccgctccggcgaggacaccacccgcccggcgtggccgatg
atcgtgctgcgcagccccaagggctggaccgggccgtccgaagtggacggactccagatc
gagggcacctggcgcgcgcaccaggtgccgctctcgggcgtgcgcgacaaccccgagcac
ctgcggatgctggagcagtggctgcgctcctaccggcccgaggagctcttcgacgcgaac
ggcgccccggtgccggagctcggcgagctggtcccgcccggccacctgcgcatgggcgcc
accccgcacgccaacggcggaaccctgctgcgcgacctgcggatgcccgcgctgagcgag
cacgccgtggccgtgcccgagcacggcggcagcacctccgagcccaccagggtcctcgga
cggctgctgcgcgacgtggtcgagctcaacgacgcccagcgcaacttccgcctgttcggc
ccggacgagaccgcctccaaccggctcgacgccgtctacgaggtcaccggcaagcagtgg
cagggcgagaccctgcccgtggacgaccacctggtgcgcgcgggccgcgtcgtggaggtg
ctgtccgagcacctgtgccagggcttcctggagggctacctgctcaccgggcggcacggc
ctgttcaactgctacgaggcgttcacgcacatcgtcgactcgatgttcaaccagcacgcc
aagtggctgggcacgcaccgcaagctcggctggcgccgcccgatcgcgtcgctgaactac
ctgctcagctcgcacgtgtggcgccaggaccacaacgggttctcccaccaggaccccggt
ttcatcgaccacgtcatgaacaagaaggccgaggtcgtccgcgtctacctgccgccggac
accaacaccctcctgtcggtcgcggaccactgcctgcgcagccgcgaccacgtgaacgtg
gtggtggcgggcaagaaccagaccccggactggctcggcccgcaggaggcggcgctgcac
tgcgccaggggcctgggcatctgggagtgggcaggcaacgacgacggtgtggaggagccg
gacgtggtcatggcctgcgccggcgacgcccccacggtcgaggtgatggccgcggtgtcc
ctgctgcgcgagcacctgccgtcgctgcgggtccgcgtggtcaacgtggtcgacctgatg
cggttgcagccggagagcgagcacccgcacggcctgtcggaccacgagttcgacgcgatc
ttcaccaccgaccggccggtgctgttcgcctaccacggctacccgtggctgatccaccgc
ctgacctaccggcgcaccaaccacaacaacatccacgtgcgcgggtacaaggaggagggc
accaccaccacgccgttcgacatgctggtgctcaacgacatggaccgctaccggctggtc
atggacgtgatcgaccgggtgccgggcctcgggccgcgcaccgcccggctgcgccagctg
atgaccgaccagcgcaccaggcacaacgcgtggatccgggagcacggcgaggacctgccc
gaggtgcgggactggagctggcggtcctga

DBGET integrated database retrieval system