KEGG   Actinosynnema mirum: Amir_2192Help
Entry
Amir_2192         CDS       T00957                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ami  Actinosynnema mirum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Amir_2192
Enzymes [BR:ami01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Amir_2192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2424621..2426006
Genome map
AA seq 461 aa AA seqDB search
MTSRLPTTVGELRASGHQPRGVKAEIRENLLAALRSGRDPWPGIVGFDRTVLPQLERALL
AGHDVVLLGERGQGKTRLLRTIVGLLDEWTPVIEGAELGEHPLDPITPESKRRAAELGDD
LPVVWRHRDDRFAEKLATPDTSVGDLVGDVDPVKVAQGRSLGDPETIHYGLLPRSHRGVI
AVNELPDLAERIQVSLLNVMEERDIQIRGYTLRLPLDVLLVATANPEDYTNRGRIITPLK
DRFGAEIRTHYPLEVAAEVDLVRQEADLVAEVGDHLLEVVARFVRHLRESSAIDQRSGVS
ARFAVAAAETVAAAALRRSALTGESPAVARPVDLESVPEVLRGKLEFEAGEEGREQEVLT
HLLRRSVADTARAALAGVDLRQLAEAVSDGHPVATGERVTAAELLGALPELPVLHEVATR
LGADPSGPAGRIASAVELALESLYLTRRLAKDADDDRSVYG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgacctctcgacttcccaccaccgtcggcgaactgcgcgcctcgggacaccagccgcgc
ggggtcaaggccgagatcagggagaacctgctcgccgccctgcgctccggccgcgacccg
tggccgggcatcgtcggcttcgaccgcaccgtcctgccgcagctggagcgggccctgctc
gccgggcacgacgtcgtcctgctgggcgagcgcggccagggcaagacccgcctgctgcgc
acgatcgtcggcctgctcgacgagtggacgcccgtcatcgagggcgccgagctgggcgag
cacccgctcgacccgatcacccccgagtccaagcgccgcgccgccgagctgggcgacgac
ctgcccgtcgtctggcggcaccgggacgaccggttcgccgagaagctcgccacccccgac
acctccgtcggcgacctcgtcggcgacgtcgacccggtcaaggtcgcccagggccgcagc
ctcggcgaccccgagaccatccactacggactcctcccgcgctcgcaccggggtgtcatc
gccgtcaacgagctgcccgacctggccgagcgcatccaggtgtcgctgctcaacgtcatg
gaggagcgcgacatccagatccgcgggtacaccctgcggctgccgctggacgtgctgctc
gtcgccaccgccaaccccgaggactacacgaaccggggacgcatcatcaccccgctcaag
gaccggttcggcgccgagatccgcacccactaccccctcgaggtcgccgccgaggtggac
ctggtccgccaggaggccgacctcgtcgccgaggtgggcgaccacctgctggaggtcgtg
gcccggttcgtgcgccacctgcgcgagtcgtccgcgatcgaccagcgctccggcgtctcc
gcccggttcgcggtcgccgccgccgagaccgtggccgccgccgcgctgcgccgctccgcc
ctcaccggcgagtccccggccgtcgcccgcccggtcgacctggagtcggtgcccgaggtg
ctgcgcggcaagctggagttcgaggccggtgaggagggccgcgagcaggaggtgctcacc
cacctgctgcgccgctccgtcgccgacaccgcccgcgccgcgctcgcgggcgtcgacctg
cgccagctcgccgaggccgtctcggacgggcacccggtggccaccggcgagcgggtcacc
gccgccgagctgctcggcgcgctgccggagctgcccgtgctgcacgaggtcgccacccgc
ctcggcgccgacccctcggggccggccgggcgcatcgcgtccgccgtcgagctggccctg
gagtcgctgtacctgaccaggcggctggccaaggacgcggacgacgaccgatcggtgtac
gggtga

DBGET integrated database retrieval system