KEGG   Actinosynnema mirum: Amir_2275Help
Entry
Amir_2275         CDS       T00957                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ami  Actinosynnema mirum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_2275
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_2275
   00620 Pyruvate metabolism
    Amir_2275
   00640 Propanoate metabolism
    Amir_2275
  Energy metabolism
   00680 Methane metabolism
    Amir_2275
Enzymes [BR:ami01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Amir_2275
Lipid biosynthesis proteins [BR:ami01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Amir_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2523842..2525509
Genome map
AA seq 555 aa AA seqDB search
MDFRQARDFLLQHADDHDAARAGFAWPDLAEFNWALDWFDEIARDNDRTALWIVEEDGSE
GRWSFAELSRRSAQVANWLRGNGVARGDRVVLMLGNQVQLWETLLGAMKLGAVVIPATTL
LGPEDLRDRIERGGARHVVVTSGDAPKFAEVPGDYTRIAVGAPVDGWLDFADSERADAAF
TPDAPTRADDTLLLYFTSGTTAAPKLVEHTHVSYPVGHLSTMYWQGLRPGDVHLNISSPG
WAKHAWSNVFAPWNAEATVFVHNYRRFDAARLMAEMDRCGVTSFCAPPTVWRMLIQADLT
ALRVPPRKAVGAGEPLNPEVIEQVAKAWGVTVRDGFGQTETTVQIANTPGQPVKPGSMGR
PAPGYEVVLVDPITGEPGTEGEICLDLSRRPLGLMVGYHGDPERTAEVMRGGYYHTGDVA
SVDEDGHLTYVGRTDDLFKSSDYRISPFELESVLLEHDAVAEAAVVPSPDPVRLAVPKAH
VVLAPGWEPTAETALAVLRHARERLAPYKRVRRLEFGPLPKTISGKIRRVELREQEDGGR
PDGEHREEDFPQLRG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggacttccgccaagcccgcgacttcctcctccagcacgccgacgaccacgacgccgcc
cgcgcgggcttcgcctggcccgacctcgccgagttcaactgggcgctggactggttcgac
gagatcgcccgcgacaacgaccgcaccgcgctgtggatcgtggaggaggacggctccgag
ggccgctggtcgttcgccgagctgtcccgccgctccgcgcaggtcgcgaactggctgcgc
ggcaacggcgtcgcgcgcggcgaccgggtcgtgctcatgctcggcaaccaggtgcagctg
tgggagaccctgctcggcgcgatgaagctcggcgcggtcgtcatccccgccaccaccctg
ctcggcccggaggacctgcgcgaccggatcgagcgcggcggcgcgcggcacgtggtcgtc
acgagcggggacgcgcccaagttcgccgaggtccccggcgactacacccgcatcgcggtc
ggcgccccggtcgacggctggctcgacttcgccgacagcgagcgcgccgacgccgcgttc
accccggacgcgcccacccgcgccgacgacaccctgctgctctacttcacctccggcacc
accgccgcgcccaagctggtcgagcacacccacgtctcctacccggtcgggcacctgtcc
accatgtactggcagggcctgcgccccggcgacgtgcacctgaacatctcctcgcccggc
tgggccaagcacgcctggagcaacgtcttcgccccgtggaacgccgaggccacggtgttc
gtgcacaactaccgccggttcgacgcggcccggctgatggcggagatggaccgctgcggg
gtgaccagcttctgcgcgccgccgaccgtgtggcggatgctcatccaggccgacctgacc
gcgctgcgcgtgccgccccggaaggccgtcggcgcgggcgagccgctcaacccggaggtg
atcgagcaggtcgcgaaggcgtggggggtgaccgtgcgggacgggttcgggcagaccgag
acgaccgtgcagatcgccaacacccccggccagccggtcaagccggggtcgatgggcagg
ccggcgcccggttacgaggtggtgctggtcgacccgatcaccggggagccggggaccgag
ggcgagatctgcctcgacctgtcccgcaggccgctcgggctgatggtcggctaccacggc
gacccggagcgcaccgccgaggtgatgcgcggcggctactaccacaccggggacgtcgcg
tcggtggacgaggacgggcacctgacgtacgtggggcgcacggacgacctgttcaagtcc
tcggactaccggatctcgccgttcgagctggagagcgtgctgctggagcacgacgcggtg
gcggaggcggcggtcgtgccctcgccggacccggtgcggctggcggtgccgaaggcgcac
gtggtgctcgcgcccggctgggagccgacggcggagacggcgctggcggtgctgcggcac
gcgcgggagcggctggccccgtacaagcgggtgcggcggctggagttcgggccgctgccc
aagacgatctccgggaagatccgccgggtcgagctgcgcgagcaggaggacggcgggcgc
cccgacggcgagcaccgcgaggaggacttcccgcagctgcgcgggtga

DBGET integrated database retrieval system