KEGG   Actinosynnema mirum: Amir_2425Help
Entry
Amir_2425         CDS       T00957                                 

Definition
Cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ami  Actinosynnema mirum
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Amir_2425
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Amir_2425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2693123..2694754)
Genome map
AA seq 543 aa AA seqDB search
MTRSVSRRSFLAGAGTALGATAFSGGASASGSTAPGAPASGRSPAGIPDGARVPALVVGS
GYGGAVAALRLAQAGVPVHVVEKGRSWDEPGWDGKVFANMLNPDERSYWLRTWTKQPLSN
FLGLPVDRAVPRRTGILDAEEFAGITVYQGRGVGGGSLVNGGMAVTPRRERFAAVLPGVD
PEEMYSTYYPLANAELGTGLVDPDWWEQAECYRYARVGRAQAQRSGFPFELVPGVYDWAH
LEREEAGTAPRSALAAEVIYGNNHGKLSLPRTYLARALATGRVTISALHEVTSVRAVGGG
YEALLDVLDTNGRVTSTKRVEAERVFFAAGSVGTSKLLTRLRDTGALPALSPEVGLGWGE
NGNVMVGRANKASDPTGALQSCIPTGGIDNWAAGGAFAEVAPLPTGVETFTSFYLAITAN
PRRGRFTWNPEAGRVELDWRQEWKQPSVDMARTIFDRINSVEGTVYRADLFGAGKVWGDG
LTYHPLGGVVLGRATDGHGRLAGYRGLYVVDGSLIPGNTSVNPFVTITALAERNLARIVA
RDL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggtccgtttcccgcagatccttcctcgcaggcgcaggcacggcgttgggcgcg
accgcgttcagcggcggcgcttcagcgtcgggcagcacggcgccaggcgccccggcgtcg
ggccgctcccccgccgggatccccgacggggcgcgcgtgcccgcgctggtcgtcggctcc
gggtacggcggcgcggtggccgcgctgcggctggcgcaggcgggcgtgccggtgcacgtg
gtcgagaagggccggtcgtgggacgagccggggtgggacggcaaggtcttcgcgaacatg
ctcaaccccgacgagcgctcgtactggctgcgcacctggaccaagcagccgctcagcaac
ttcctcggcctgccggtggaccgcgccgtcccgcgccgcaccggaatcctggacgccgag
gagttcgccgggatcaccgtctaccaggggcggggcgtgggcggcgggtcgctggtcaac
gggggcatggcggtgacgccccggcgggagcggttcgcggcggtcctgccgggcgtggac
cccgaggagatgtactcgacgtactacccgctggcgaacgccgagctgggcaccgggctg
gtcgacccggactggtgggagcaggccgagtgctaccggtacgccagggtggggcgggcg
caggcgcagcggtccgggttcccgttcgagctggtgcccggcgtgtacgactgggcgcac
ctggagcgcgaggaggccgggaccgcgccccggtcggcgctggccgccgaggtgatctac
ggcaacaaccacgggaagctgtcgctgcccaggacgtacctggcgcgggcgctggccacc
gggcgggtgacgatctcggcgctgcacgaggtgacgagcgtgcgggcggtcggcggcggg
tacgaggcgctgctcgacgtgctggacacgaacgggcgggtgacgtccaccaagcgggtg
gaagcggagcgggtgttcttcgcggccgggagcgtggggacgagcaagctgctgacccgg
ttgcgggacaccggggcgctgcccgcgctgagcccggaggtcgggctggggtggggggag
aacgggaacgtgatggtggggcgggcgaacaaggcgtccgacccgaccggggcgctccag
tcgtgcatcccgaccggcgggatcgacaactgggcggcgggcggggcgttcgccgaggtc
gcgccgctgccgaccggggtcgagacgttcacgtcgttctacctggcgatcacggccaac
ccgaggcgcgggcggttcacctggaacccggaggcggggcgggtcgagctggactggcgg
caggagtggaagcagccgtcggtcgacatggcgcggacgatcttcgaccggatcaactcg
gtcgaggggacggtgtaccgggcggacctgttcggggcggggaaggtgtggggcgacggg
ctgacgtaccacccgctgggcggggtggtgctggggcgggcgacggacgggcacgggcgg
ctggcggggtaccgggggctgtacgtggtggacgggtcgctgattccggggaacacgagc
gtgaacccgttcgtgacgatcacggcgctggcggagcggaacctggcccggatcgtggcg
cgggacctgtag

DBGET integrated database retrieval system