KEGG   Actinosynnema mirum: Amir_3142Help
Entry
Amir_3142         CDS       T00957                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ami  Actinosynnema mirum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Amir_3142
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_3142
  Lipid metabolism
   00071 Fatty acid degradation
    Amir_3142
  Amino acid metabolism
   00350 Tyrosine metabolism
    Amir_3142
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Amir_3142
   00626 Naphthalene degradation
    Amir_3142
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Amir_3142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3628412..3629452)
Genome map
AA seq 346 aa AA seqDB search
MKAVQYREIGKAPEVVTVPDPEAGPGQVVLEVAAAGVCHSDIAVMEWPAEVYGYGFPLTL
GHEGVGKVAALGQGVTGLEVGEMVAVYGPQGCGSCAKCAEGKENYCLRAAELGINPPGLG
APGAMAEYMLIDNARHLVPLGDLDPVSAAPLTDAGLTPYHAIKKSLPKLVPGSTAVVIGT
GGLGHMAIQILRATTAARVIALDVSKEKLELAAAVGAHETVLSDADATKAVRELTGGLGA
EVVLDFVGVGPTVATAAGVVAVEGDLTVVGIGGGTVPVGFGTIPFDVSVSTPYWGSRGEL
IEVLDLARSGALTVHTETFGIDEAPLAYERLHAGQVRGRAVVLPRG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtgcagtaccgcgagatcggcaaggcccccgaggtcgtcaccgtccccgac
cccgaggccggtcccggccaggtcgtgctggaggtggccgccgcgggcgtgtgccactcg
gacatcgccgtgatggagtggcccgccgaggtctacggctacggcttccccctcaccctg
ggccacgagggcgtcggcaaggtcgccgccctcgggcagggcgtcacgggcctggaggtc
ggcgagatggtcgccgtctacggcccgcagggctgcggctcgtgcgccaagtgcgccgag
ggcaaggagaactactgcctgcgcgccgccgagctgggcatcaacccgcccggactgggc
gcgccgggcgcgatggccgagtacatgctgatcgacaacgcccgccacctggtgccgctg
ggcgacctcgacccggtctcggccgccccgctcaccgacgcgggcctcacgccgtaccac
gcgatcaagaagtcgctgcccaagctggtccccggcagcaccgccgtggtcatcggcacc
ggcggcctcggccacatggccatccagatcctgcgcgccaccacggcggcccgggtgatc
gcgctggacgtgtcgaaggagaagctggagctggcggcggcggtcggcgcgcacgagacc
gtgctgtccgacgcggacgccaccaaggccgtgcgcgagctgaccggcggcctgggcgcc
gaggtcgtgctcgacttcgtgggcgtcggcccgacggtggccacggcggcgggcgtcgtc
gcggtcgagggcgacctgaccgtggtcggcatcggcggcggcaccgtgccggtcggcttc
ggcacgatcccgttcgacgtgtcggtgtccaccccgtactggggcagccggggcgagctg
atcgaggtgctggacctggcccggtccggcgcgctgaccgtgcacaccgagaccttcggc
atcgacgaggcgccgctggcgtacgagcggctgcacgccggtcaggtgcgcgggcgcgcg
gtcgtgctgccgcgcggctga

DBGET integrated database retrieval system