KEGG   Actinosynnema mirum: Amir_3214Help
Entry
Amir_3214         CDS       T00957                                 

Definition
(GenBank) Endo-1,4-beta-xylanase
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ami  Actinosynnema mirum
Brite
Enzymes [BR:ami01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Amir_3214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_10 CBM_2 Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: ACU37122
JGI: Amir_3214
UniProt: C6W8M3
Position
complement(3744954..3746327)
Genome map
AA seq 457 aa AA seqDB search
MELTSRSVSRAGFGAVALAAALGATLLVSTPASAATTLGAAAAQTGRYFGAAVAAGRLND
STYVNILNREFNSVTAENEMKWDATEPNRGQFNYTAGDRILNQALSNGKRVRGHALLWHQ
QQPGWAQSLSGSALRQAALNHVTQVATHYRGKIHSWDVVNEAFADGGSGGRRDSNLQRTG
NDWIEAAFRAARAADPAAKLCYNDYNTDGINAKSTGIYTMVRDFKSRGVPIDCVGLQSHL
TNNAPSDYQANIKRFADLGVDVQITELDIAGSNQANAFGAVTRACLAVPRCTGITVWGIR
DTDSWRGGENPLLFDGSGNKKAAYTSVLNALNAGGTTVPGETPPTTTPPTTPPTTTNPPQ
PGGCTASVSVNSWEGGFVATVKVTAGSSALNGWKVTTALPSGTSVTGSWSASGSGTSGTV
DWTNVAYNGAVAAGQSTEFGFQGTGSAAGLSPACAAS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacatcgaggtcagtgtcccgagccgggttcggcgcggtggcgctggccgcc
gcgctcggagccaccctgctcgtgagcacccccgccagcgccgccacgaccctgggcgcc
gcagccgcccagaccggccggtacttcggcgcggccgtcgcggcgggcaggctgaacgac
tcgacctacgtgaacatcctgaaccgcgagttcaactcggtcaccgccgagaacgagatg
aagtgggacgccaccgagcccaaccgcggccagttcaactacaccgccggtgaccggatc
ctcaaccaggcgctcagcaacggcaagcgggtgcgcgggcacgccctgctgtggcaccag
cagcagccgggctgggcgcagagcctgagcgggtcagccctgcggcaggccgcgctcaac
cacgtcacccaggtcgccacccactaccggggcaagatccactcctgggacgtggtgaac
gaggcgttcgccgacggcggctccggaggccgccgggactcgaacctccagcgcaccggc
aacgactggatcgaggccgcgttccgcgccgcccgcgcggccgaccccgccgcgaagctg
tgctacaacgactacaacaccgacgggatcaacgcgaagtccaccgggatctacaccatg
gtgcgggacttcaagtcgcgcggcgtgccgatcgactgcgtgggcctccagtcgcacctg
acgaacaacgcgccgtcggactaccaggccaacatcaagcgcttcgcggacctgggcgtg
gacgtgcagatcaccgagctggacatcgcgggctccaaccaggccaacgccttcggcgcg
gtgacccgcgcgtgcctggccgtgccgcgctgcaccggcatcaccgtgtggggcatccgc
gacaccgactcgtggcgcggcggcgagaacccgctgctgttcgacggcagcggcaacaag
aaggccgcctacacctcggtgctgaacgcgctgaacgcgggcggcacgaccgtgccgggc
gagaccccgccgaccaccactcccccgaccaccccgcccaccacgacgaacccgccgcag
ccgggcggctgcacggcgtcggtgtcggtgaactcgtgggagggcggtttcgtcgccacg
gtcaaggtgaccgccgggtcgagcgcgctgaacggctggaaggtcaccaccgcgctgccg
tcgggcacgtcggtgaccggctcgtggagcgcgagcggcagcggcacgtccggcacggtg
gactggaccaacgtcgcctacaacggggccgtcgcggcgggccagtcgaccgagttcggc
ttccagggcaccgggagcgccgccggtctctccccggcctgcgcggcgagctga

DBGET integrated database retrieval system