KEGG   Actinosynnema mirum: Amir_3368Help
Entry
Amir_3368         CDS       T00957                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ami  Actinosynnema mirum
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Amir_3368
Enzymes [BR:ami01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Amir_3368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3941285..3943633
Genome map
AA seq 782 aa AA seqDB search
MTTTQTSGTEAVQRYRRACDYAAAAMIYLRDNTLLREPLRREHLKPRLLGHWGTCPGITF
LHAGLNGLVRRTGQRTLLVTGPGHGAPAVHANLWLEGTHAELDPALSRDGAGLAELVRRF
SWPGGFPSHLSPEVPGVIHEGGELGYALATAFGAAMDKPDLLVACLVGDGEAETGPTAGS
WHASKYLSPRTDGVVLPVLHANGYKISSPTVYGCMDDEELTAYFSGAGWSPRVVDVTRAD
DPDALMAEALDRAHAEIAELRERWRPGERAVRPMLVLRSPKGWGVPERDAGGDPLEGTFR
AHQVPLGAVHEDDDELALLERWLRSYRPEELFDADGRPHEDLLAQLPPEHLRLGRVPEAN
GGRLRRDLPLPDVADFAARVPAPGTGSTSPTEVAGRWLAELVRATEDRRDFRVLCPDELE
SNKLGALLEATDRGFTWPLPDTAEHVAPGGRVLEVLSEHLCQGWAQGYLLTGRHALFPCY
EAFASIVDSMVDQHAKFLKISGEVPWREPVASLNYLLTSEGWRQEHNGYSHQGPGFLNNL
LTKKAATARVYLPPDANTLLVTLRDCLASTGRINLVVAGKNAGAQWLDLEAAERHCAAGA
GVWDWACHGDGDPDVVLACAGGVPTVEALAAAAILRERAPEVTVRVVNVVDLLALAPADR
HPHGLPDDVFAACFPQDVPVVFAFHGYPSAVREAVHGRPGADRFHVHGYLEEGTTTTPYD
LLVANRMSRHDLAADALRRAGRGVDRDTDLAERLLAERDDLVAAAHRDGVDPEEIAEWRW
GA
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccacgcagacgagcggcaccgaggccgtccagcgctaccgcagggcgtgcgac
tacgccgccgcggccatgatctacctcagggacaacaccctgctgcgcgagccgctgcgc
cgcgagcacctcaagccgaggctgctcggccactggggcacctgccccggcatcaccttc
ctgcacgccggcctcaacggcctggtgcggcgcaccgggcagcggacgctgctggtcacc
ggtcccggccacggcgcgcccgccgtgcacgcgaacctgtggctggagggcacgcacgcc
gagctggacccggccctgagccgcgacggcgcgggccttgcggagctggtgcgccgcttc
tcctggcccggcggcttccccagccacctctcgccggaggtgcccggcgtgatccacgag
ggcggcgagctgggctacgcgctcgccaccgccttcggtgcggccatggacaagccggac
ctgctggtggcgtgcctggtgggcgacggcgaggccgagaccggccccacggcgggctcc
tggcacgcgagcaagtacctgtccccgcgcaccgacggcgtggtcctgccggtgctgcac
gccaacggctacaagatctcctcgcccacggtctacggctgcatggacgacgaggagctg
accgcctacttcagcggcgcgggctggtcgccgcgggtggtcgacgtgacccgcgccgac
gacccggacgccctgatggccgaggcgctggaccgcgcgcacgccgagatcgccgagctg
cgcgagcggtggcggccgggggagcgggcggtgcgcccgatgctggtgctgcgctccccg
aagggctggggcgtgcccgagcgcgacgccgggggcgaccccctcgaaggcacgttccgc
gcccaccaggtgccgctcggcgcggtccacgaggacgacgacgagctggccctgctggag
cgctggctgcggtcctaccgccccgaggagctgttcgacgccgacggccgcccgcacgag
gacctcctggcccagctgcccccggagcacctgcgcctcggccgcgtgccggaggccaac
ggcggacggctgcgccgcgacctgcccctgcccgacgtggcggacttcgccgcgcgggtc
cccgcgcccggcacgggctcgaccagcccgaccgaggtggcgggccgctggctggccgag
ctggtgcgggccaccgaggaccggcgcgacttccgcgtgctctgccccgacgagctggag
tccaacaagctcggcgccctcctggaggccaccgaccggggcttcacctggccgctgccg
gacaccgccgagcacgtcgcgcccggcggccgggtgctggaggtgctgtccgagcacctg
tgccagggctgggcgcagggctacctgctgaccggtcggcacgcgctgttcccgtgctac
gaggcgttcgcctcgatcgtggacagcatggtcgaccagcacgccaagttcctcaagatc
tccggcgaggtgccgtggcgcgagccggtggcgagcctgaactacctgctcaccagcgag
gggtggcggcaggagcacaacggctacagccaccagggccccggtttcctcaacaacctg
ctcaccaagaaggccgcgaccgcgcgcgtctacctgccgccggacgcgaacaccctgctg
gtgaccctgcgggactgcctggcctccaccgggcggatcaacctggtggtcgcgggcaag
aacgcgggcgctcagtggctggacctggaggcggccgagcggcactgcgcggcgggcgcg
ggcgtgtgggactgggcctgccacggcgacggcgacccggacgtggtgctggcgtgcgcg
ggcggcgtccccaccgtggaggcgctggcggcggcggcgatcctgcgcgagcgggccccc
gaggtgaccgtgcgcgtggtcaacgtggtggacctgctcgcgctggcccccgccgaccgc
cacccgcacggcctgcccgacgacgtcttcgccgcgtgcttcccgcaggacgtcccggtg
gtcttcgccttccacggctacccgtcggccgtgcgcgaggcggtgcacggccgccccggc
gccgaccggttccacgtccacggctacctggaggagggcaccacgaccacgccctacgac
ctgctcgtggccaaccgcatgagccgccacgacctggccgccgacgcgctgcgccgggcc
ggtcgcggcgtcgaccgcgacaccgacctggccgagcggttgctggccgagcgcgacgac
ctggtcgcggcggcgcaccgcgacggcgtggaccccgaggagatcgccgagtggaggtgg
ggcgcatga

DBGET integrated database retrieval system