KEGG   Actinosynnema mirum: Amir_3831Help
Entry
Amir_3831         CDS       T00957                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ami  Actinosynnema mirum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ami00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4494850..4496166)
Genome map
AA seq 438 aa AA seqDB search
MDLDRDDLDGDLDVAVVGGGIAGLAAAHAARASGGRVRVFEAADHVGGRMSTLRVDGFLA
DTGAEQLPERGYDATWSLLAELGVDRADVPLIGRRVGMWRGGRVRPGVADALGLLTGAGL
GLRARLDARRALGSGHDLDRPEDSGTATVVEHLARYHRDVLEYLLQPVVSGFFGWRPERS
AAGPALALLGSVGTASTWRVYPDGMDSLARALADRLDVETSARVNEVVADRDGARLVVGG
REVPARRVVLAVPAPVALDLHANPPEREAEFLRACTFTPVVKVHLLLDRPLPSAAYLVTV
PRAESDVVSAIAFDHLKHPGRAPEGKGLLTVIANPVLAPRLARLPDADVADMLTRATEKF
APGLGEAVTGALVHRFRHGLPEATPRALGLRAGFDAALGSSTVDYAGDWVLLSPCSEAAV
RTGLRAGARAVARRGELV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggacctggaccgggacgacctcgacggcgacctcgacgtcgccgtcgtcggcgggggc
atcgccgggctcgccgccgcgcacgccgcgcgcgcctcgggcggccgggtgcgggtgttc
gaggcggccgaccacgtcggcgggcgcatgtcgacgctgcgcgtggacggcttcctcgcc
gacaccggggccgagcagctgcccgagcgcggctacgacgccacctggtcgctgctggcc
gagctgggcgtcgaccgcgccgacgtgccgctgatcgggcggcgggtcgggatgtggcgc
ggcggccgggtccggcccggcgtcgccgacgcgctcgggctgctcaccggcgccgggctg
ggcctgcgggcgcggctggacgcgcggcgcgcgctcggctccggccacgacctggaccgg
ccggaggactccggcacggccaccgtcgtcgagcacctggcccgctaccaccgggacgtg
ctggagtacctgctccagcccgtggtgtccgggttcttcggctggcggcccgagcgctcg
gccgccgggcccgcgctggcgctgctcggctcggtcgggaccgcgtccacctggcgggtc
tacccggacggcatggactccctcgcccgcgcgctggccgaccggctcgacgtggagacc
tccgcgcgggtcaacgaggtcgtggccgaccgggacggcgcccggctggtggtcggcggc
cgggaggtcccggcccgccgggtcgtgctggccgtgcccgccccggtcgcgctggacctg
cacgccaacccgcccgagcgggaggcggagttcctgcgggcctgcacgttcacgccggtg
gtcaaggtccacctgctgctggaccggccgctgccgtccgccgcctacctggtgaccgtg
ccgcgcgcggagagcgacgtcgtctccgccatcgccttcgaccacctcaagcaccccggc
cgcgcccccgagggcaaggggctgctgaccgtgatcgccaacccggtgctcgcgccccgg
ctggccaggctgcccgacgcggacgtcgccgacatgctcacccgcgccaccgagaagttc
gcgccgggcctgggcgaggcggtcaccggcgcgctggtgcaccggttccggcacgggctg
cccgaggccacgccgagggcgctgggcctgcgcgccgggttcgacgccgcgctcggttcg
tccaccgtggactacgcgggcgactgggtgctgctcagcccgtgcagcgaggccgccgtc
cgcaccggcctgcgcgccggggcccgcgccgtcgccaggaggggtgagctggtgtga

DBGET integrated database retrieval system