KEGG   Actinosynnema mirum: Amir_4021Help
Entry
Amir_4021         CDS       T00957                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ami  Actinosynnema mirum
Pathway
ami00520  Amino sugar and nucleotide sugar metabolism
ami01100  Metabolic pathways
ami01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Amir_4021
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Amir_4021
Enzymes [BR:ami01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Amir_4021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 DUF1707
Motif
Other DBs
NCBI-ProteinID: ACU37884
JGI: Amir_4021
UniProt: C6WFU8
Position
complement(4720433..4721644)
Genome map
AA seq 403 aa AA seqDB search
MEQHGRDPRRSPARRGASAAKLGSVALGAVLAASVLTGVALNRDDTVTGAAVPEGGTTET
GETTTTTTSTPPPDPCAPVLAGLTPRAGLAQLLQVGVNPRGPQDALSIVGSEQVGGIFVG
GDDVGLLSGDALAAVHAASTLPLTVSVDDEGGRVQRIDALDGDIPSARTMTRTLSTEQVR
ELARKRGEAMKARGVNTDLAPVLDLTSQAANTVIGDRSFSVDPATAVSYAEAFAEGLRQA
GVVSVVKHFPGHGNTSGDSHLGSVTAPPLAQLRAHDLAPYRELPRFGEDVQVMVGHIAVP
DLTGGLPASLSPAAYELLRGEFAFDGLVMTDDLGAMRAVTDLADLPDAVLRALVAGADVA
LWSSGGRVGEVLDRLQAAVASGELSAERVDRSLRRVLKSKHLC
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtggagcagcacggcagggacccccggcgcagcccggcgcggcgcggcgcgtccgccgcc
aagctcgggtccgtcgcgctcggcgcggtgctcgccgcctccgtgctgaccggcgtcgcg
ctcaaccgggacgacaccgtcaccggcgccgccgtccccgagggcgggaccaccgagacc
ggcgagaccacgacgaccacgacctccaccccgccgcccgacccgtgcgcccccgtcctg
gccgggctgaccccgcgcgccgggctcgcccagctgctccaggtcggcgtcaacccgcgc
ggcccgcaggacgcgctgtccatcgtcggctccgagcaggtcggcggcatcttcgtcggc
ggcgacgacgtcggcctgctgtcgggggacgcgctggccgccgtgcacgccgcctccacg
ctgccgctcaccgtctcggtggacgacgagggcggccgggtgcagcggatcgacgcgctc
gacggcgacatccccagcgcccgcaccatgacccgcaccctgtccaccgagcaggtccgc
gagctggcgcgcaagcgcggcgaggcgatgaaggcgcgcggcgtcaacaccgacctcgcc
cccgtgctcgacctgacctcccaggccgcgaacaccgtgatcggcgaccgctcgttcagt
gtcgacccggccaccgccgtctcctacgccgaggcgttcgccgagggcctgcgccaggcc
ggggtcgtctcggtggtcaagcacttccccggccacggcaacacctccggcgactcgcac
ctcggctcggtcaccgcgcccccgctcgcccagctgcgcgcccacgacctcgcgccctac
cgggagctgcccaggttcggcgaggacgtgcaggtcatggtcggccacatcgccgtcccc
gacctgaccggcggcctgcccgcgagcctgagcccggccgcctacgagctgctgcgcggc
gagttcgcgttcgacggcctggtcatgaccgacgacctgggcgcgatgcgcgcggtgacc
gacctggccgacctgcccgacgcggtgctgcgcgcgctggtcgcgggcgcggacgtggcg
ctgtggtcgtccggcggccgggtcggcgaggtgctcgaccggctgcaggccgccgtcgcg
agcggcgagctgagcgccgagcgggtggaccgctcgctgcgccgcgtgctcaagtccaag
cacctctgctag

DBGET integrated database retrieval system