KEGG   Actinosynnema mirum: Amir_4634Help
Entry
Amir_4634         CDS       T00957                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ami  Actinosynnema mirum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Amir_4634
  Lipid metabolism
   00600 Sphingolipid metabolism
    Amir_4634
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Amir_4634
Enzymes [BR:ami01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Amir_4634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5516079..5520353
Genome map
AA seq 1424 aa AA seqDB search
MRRVVVATVVALSLLTPATARARPADPVDALAYLEDPRMTGENQEPPHPDLKPEQRLSLN
GEWRIRMFDKPEDVRETADGWRTVSVPHTWQTDFLDHPVFRNIPTEMYPDAPPSVPRDVN
PTGVYEKEFDLPPEWDRTLLRFEGVTSGYFVWVNGEYVGYDQGGYTPAEFDVTSRLKPGR
NAVRVQVHRWGSGSHLEDFDQWRFSGIFREVWLYSTPRTYLADVTIRTDLDADYRDATLS
ADVVLGGPAEGHSVRTRLFDPSGTEVPVVDGRVSNPLKWTDETPNVHELRVELLRDGQVV
QTGRQPVGFREIEIVDRQLKVNGKRVLFRGVNRAETSVRGSRHVTREEQEEDVRLMKRFN
VNAVRTSHYPSDPHFYELADRAGLMIADEVDTETHHHDNCPTDCLAERPEWQDAFLDRFT
GMMQRDKNHPSVVMWDTGNEAGLGRAHHAMAELARARDTRPLYHQPNVPDGDAPFADVAG
PRYPSPSSLEAKARTTTKPIIMGEYAHAMGNSLGNFKEFWDVVRAYPQVQGGFIWDWAEQ
NIALPLHTTPDDANGILAWLSGKPSRVDGPHGKALHLSGLDDFVEVYRDRRFDEVRDGLT
LDAWVKPDAWTGDFTVIAKGDHQYALKMSDAATLEFFVHSGTWRTVRARVPADWTGNWHR
VTGTFDGAALRLLIDGEQVAETAFTGTVDPSHWPVNIGRNPETMQENVRTRMAHGAIDQV
RIYHRALTGSELAADPKGSAVLALDFETVEDEGRQQSYGAGTGGVDGLVWADRRPQPETT
ELMAVHSPIRFSFADNRLTVVSERQFTGTDDLELRWEVRDNGRVVDDHRGPLVPGVVELP
DRSAVTERLLTVRATDRAGDDVGIAQFPLGGERIAGLHTGLRSGSTTTTQDENEVVVSGQ
GFRYAISKRTGTLTSMRVRGDELLTAGPKLDAWRAPLSNEFMSEDGSWYRNGLDRLTTTP
SSVEVGRDSVDAVVTVKSTAQAVAGSSFGQTFTYRITGDGEIHVGHRVAAQGAMRDLSYL
PGIGFTLKVPERYRQFTWYGRGPGENYDDRKSGDPIGLYKSTVDGQFHDYYKPQDFGNHA
DTRWATLSDGRSGLLVAGDLDVRVSRHDDLDRAAYPFALKQNDGWTTLHAAHRVTGVGET
FHEPLQPYQVEAGTEYAYSVLLRPLTPAEAATGELGGQVDCVPAVELNAPDTALEPGGRV
TAELVVTEPCASPARARVGVPDGWTATPASVDLSGGSARVVITREGGPTGTRPVFVDVVA
GKGTTTLSRDFTAVPSAPRGEARVSALEFLDERNGWGPIERDRSNGEDVGGDGNPIRLRG
TGFDAGVGVHADSEFRVHTGGRCSRLTAVVGVDDETGGTGSVRFEVLADGRQVHLSPVLT
GRSAAEAISVDTSGARVLSFRVTDGGDGNAHDHADWANPVLSCG
NT seq 4275 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtgtcgtcgtagccacggtggtagcgctctcactcctgacgcccgcgaccgcg
cgggcccgaccggccgaccccgtggacgcgctcgcgtacctggaggacccccggatgacc
ggggagaaccaggagccgccgcacccggacctgaagcccgagcagcggctcagcctgaac
ggcgagtggcggatcaggatgttcgacaagccggaggacgtgcgcgagacggcggacggc
tggcgcacggtctcggtgccgcacacctggcagaccgacttcctggaccacccggtgttc
cgcaacatcccgacggagatgtacccggacgccccgccgtccgtgccgcgcgacgtgaac
ccgaccggcgtgtacgagaaggagttcgacctcccgccggagtgggaccgcacgctgctc
cggttcgagggggtgaccagcggctacttcgtgtgggtcaacggggagtacgtcgggtac
gaccagggcgggtacacgcccgccgagttcgacgtgaccagcaggctcaagccggggcgc
aacgcggtccgggtgcaggtgcaccgctggggttccgggtcgcacctggaggacttcgac
cagtggcggttctccgggatcttccgcgaggtgtggctgtactccacgccgaggacctac
ctggcggacgtgacgatcaggaccgacctggacgcggactaccgggacgcgacgctcagc
gcggacgtggtgctcggcggtccggccgaggggcactcggtgcggaccaggctgttcgac
ccgagcgggaccgaggtgccggtcgtggacgggcgggtgtcgaacccgttgaagtggacc
gacgagacgccgaacgtccacgagctgcgcgttgagctgctgcgggacgggcaggtggtc
cagaccggcaggcagcccgtggggttccgggagatcgagatcgtggaccggcagctcaag
gtcaacgggaagcgggtgctgttccggggggtcaaccgggccgagacgagcgtgcgcggc
agccgtcacgtcacccgcgaggagcaggaggaggacgtgcggttgatgaagcggttcaac
gtcaacgcggtgcggacctcccactaccccagcgatccgcacttctacgagctggccgac
cgcgccgggctgatgatcgccgacgaggtcgacaccgagacgcaccaccacgacaactgc
cccaccgactgcctggccgagcgcccggagtggcaggacgcgttcctcgaccggttcacc
ggcatgatgcagcgggacaagaaccacccgagcgtcgtcatgtgggacaccgggaacgag
gccgggctcggcagggcgcaccacgcgatggccgagctggcgcgggcccgcgacacccgg
ccgctctaccaccagccgaacgtgccggacggcgacgcgccgttcgcggacgtggcgggg
ccgcgctacccgtcgccgtcgagcctggaggcgaaggcgcgcacgacgaccaagccgatc
atcatgggcgagtacgcgcacgcgatgggcaacagcctgggcaacttcaaggagttctgg
gacgtcgtgcgcgcctacccgcaggtgcagggcggcttcatctgggactgggccgagcag
aacatcgccctgcccctccacaccaccccggacgacgcgaacggcatcctggcgtggctg
tccggcaaaccgtcccgagtggacggaccgcacgggaaggcgttgcacctgagcgggttg
gacgacttcgtcgaggtctaccgggaccggaggttcgacgaggtgcgggacgggctcacc
ctggacgcctgggtcaagccggacgcgtggaccggcgacttcacggtcatcgccaagggc
gatcaccagtacgcgctgaagatgtccgacgccgccacgctggagttcttcgtgcacagc
gggacctggcgcaccgtccgggcgagggtgcccgccgactggaccgggaactggcaccgc
gtcaccggcacgttcgacggcgcggcgctgcggttgctgatcgacggtgagcaggtcgcg
gagaccgccttcaccgggacggtcgacccgtcgcactggccggtgaacatcgggcgcaac
cccgagaccatgcaggagaacgtgcgcacccggatggcgcacggcgcgatcgaccaggtg
cggatctaccaccgggcgctgaccgggtccgagctggcggccgaccccaagggctcggcg
gtgctggcgctggacttcgagaccgtggaggacgaggggcggcagcaatcctacggcgcg
ggcaccggcggcgtggacgggctggtgtgggcggaccgcaggccgcagccggagaccacc
gagctgatggcggtgcactcccccatccggttctcgttcgcggacaaccggttgacggtc
gtgagcgagcggcagttcaccggcaccgacgacctggagctgcgctgggaggtcagggac
aacgggcgcgtggtggacgaccaccggggcccgctcgtgccgggcgtggtcgaactgccg
gaccggtcggcggtcaccgagcgcctgctgaccgtgcgcgcgaccgaccgggcgggcgat
gacgtcggcatcgcccagttcccgctcggcggcgagcggatcgccgggctgcacacgggc
ctccggtccggcagcaccaccacgacgcaggacgagaacgaggtcgtggtgtccggccag
ggcttccgctacgcgatcagcaagaggaccgggacgctcacgtcgatgcgcgtgcgcggg
gacgagctgctcaccgccggtccgaagctggacgcgtggcgcgcgccgctgtccaacgag
ttcatgagcgaggacggctcctggtaccgcaacggcctcgaccggttgaccaccacgccg
tcgagcgtggaggtgggccgggactcggtggacgcggtcgtcaccgtgaagtcgaccgcg
caggcggtggcggggtcgtcgttcgggcagaccttcacctaccggatcaccggcgacggc
gagatccacgtcgggcaccgggtcgccgcgcagggcgcgatgcgggacctgagctacctg
ccgggcatcggtttcacgctgaaggttccggagcggtaccggcagttcacctggtacggg
cgcgggccgggcgagaactacgacgaccgcaagtccggcgacccgatcggcctgtacaag
tccactgtggacgggcagttccacgactactacaagccgcaggacttcgggaaccacgcg
gacacccggtgggcgacgctgtccgacgggcgctccggcctgctggtggcgggcgacctg
gacgtgcgggtgtcgcggcacgacgacctggaccgggccgcctacccgttcgcgctcaag
cagaacgacggctggaccacgctgcacgccgcgcaccgggtcaccggtgtgggcgagacg
ttccacgagccgctccagccgtaccaggtcgaggccgggaccgagtacgcgtactcggtg
ctgctgcgcccgctcaccccggccgaggcggccacgggcgagctgggcggccaggtggac
tgcgtgcccgccgtcgagctgaacgcccccgacaccgcgctggagccgggcgggcgggtg
acggcagagctggtggtcaccgagccgtgcgcctcgcccgcgcgggccagggtgggcgtg
ccggacggctggacggcgacgcccgcgtcggtggacctgtccggcgggtcggcgcgggtg
gtgatcacccgcgagggcgggccgaccgggaccaggccggtgttcgtggacgtggtggcg
ggcaaggggaccacgacgctgagccgggacttcaccgccgtgccgagcgcgccgcgcggt
gaggctcgggtgtccgcgctggagttcctggacgagcgcaacgggtgggggccgatcgag
cgcgaccgcagcaacggtgaggacgtcggcggtgacggcaacccgatccgcttgcggggc
accgggttcgacgcgggcgtcggggtgcacgcggactcggagttccgggtgcacaccggc
gggcggtgctcccggttgacggccgtggtcggggtggacgacgagaccggcggcacgggc
agcgtccggttcgaggtgctcgcggacgggcggcaggtgcacctgagcccggtgctgacc
gggcggagcgcggccgaggcgatcagcgtcgacacctccggggcgcgggtgctctcgttc
cgggtgaccgacggcggtgacggcaacgcgcacgaccacgccgactgggcgaacccggtg
ctgagctgcgggtga

DBGET integrated database retrieval system