KEGG   Actinosynnema mirum: Amir_4730Help
Entry
Amir_4730         CDS       T00957                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ami  Actinosynnema mirum
Pathway
ami00240  Pyrimidine metabolism
ami01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Amir_4730
Enzymes [BR:ami01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Amir_4730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACU38560
JGI: Amir_4730
UniProt: C6WN47
Position
5641562..5642863
Genome map
AA seq 433 aa AA seqDB search
MPKVEPFDAVDVLRAKRNGQRLSTEQIGWIVDAYARGRVADEQMSALLMAIWLNGMSREE
TRDLTLAIVASGERMSFADLGKPTTDKHSTGGVGDKITLPLTPLVASFGVAVPQLSGRGL
GHTGGTLDKLESIPGWRADLSTEDIVAQLRDVGGVVAAAGSGLAPADKKLYALRDTTATV
DAIPLMASSIMSKKIAEGTGALVLDVKFGSGAFLTDLADARELARTMVELGEDAGVATSA
LLTNMNVPLGRAIGNANEVAESVAVLEGGGPADVRELTLALAREMLALAGRPDEDVAAAL
DDGRALATWRRMVRAQGGDPDAALPTAREHEVVRADRDGVLVEQRALPFGIAAWRLGAGR
ARKEDPVQHAAGVELHVKPGEAVRAGQPLFTLSADEAARIPRALESLAGAWRIGDAGDEV
QGGGPLIAERVGR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgccgaaggtcgaacccttcgacgccgtcgacgtgctgcgcgccaagcgcaacgggcag
cggctgtccaccgagcagatcggctggatcgtcgacgcgtacgcgcgcggtcgggtcgcg
gacgagcagatgtccgcgctgctgatggcgatctggctcaacggcatgagccgcgaggag
acccgcgacctgacgctggccatcgtcgcctcgggcgagcggatgtccttcgcggacctg
gggaagcccaccaccgacaagcactccaccggcggggtcggcgacaagatcacgctgccg
ctgacgccgctggtcgcgtcgttcggcgtggcggtgccgcagctgtccgggcgcgggctc
ggccacaccggcggcacgctggacaagctggagtcgatccccggttggcgcgccgatctg
tccacagaggacatcgtcgcgcagctgcgcgacgtcgggggcgtggtggcggcggccggg
tccggcctggcgcccgccgacaagaagctgtacgcgctgcgggacaccacggcgaccgtc
gacgcgatcccgctgatggcgtcctcgatcatgtcgaagaagatcgccgagggcacgggc
gcgctggtgctggacgtgaagttcggctcgggcgcgttcctgaccgacctcgcggacgcg
cgcgagctggccaggaccatggtggagctgggcgaggacgcgggcgtggcgacgagcgcg
ctgctgaccaacatgaacgtgccgctggggcgggcgatcggcaacgcgaacgaggtcgcc
gagtcggtggcggtgctggagggcggcggcccggcggacgtgcgggagctgaccctggcg
ctggcgcgggagatgctggcgctggcgggcaggccggacgaggacgtggccgccgcgctg
gacgacggccgcgcgctggcgacgtggcggcggatggtgcgcgcgcagggcggcgacccg
gacgcggccctgccgaccgcgcgcgagcacgaggtggtgcgggccgaccgcgacggcgtc
ctcgttgagcagcgagcactcccgttcggcatcgcggcctggcggttgggcgcgggccgg
gcgcgcaaggaggacccggtgcagcacgcggcgggcgtcgagctgcacgtgaagccgggc
gaggcggtcagggcggggcagccgctgttcacgctgagcgcggacgaggcggcgcgcatc
ccgcgcgcgctggagtccctggcgggcgcgtggcggatcggcgacgcgggcgacgaggtg
cagggcggcggtccgctgatcgccgagcgggtcggccgctga

DBGET integrated database retrieval system