KEGG   Actinosynnema mirum: Amir_5197Help
Entry
Amir_5197         CDS       T00957                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ami  Actinosynnema mirum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_5197
   01230 Biosynthesis of amino acids
    Amir_5197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Amir_5197
   00051 Fructose and mannose metabolism
    Amir_5197
   00562 Inositol phosphate metabolism
    Amir_5197
Enzymes [BR:ami01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Amir_5197
Exosome [BR:ami04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Amir_5197
  Exosomal proteins of bladder cancer cells
   Amir_5197
  Exosomal proteins of melanoma cells
   Amir_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6192700..6193485)
Genome map
AA seq 261 aa AA seqDB search
MARTPLIAGNWKMNLNHLEAIALVQKIAFALPEKYYAKVEVAVLPPFTDIRSVQTLVDGD
KLLLKYGAQDLSPHDSGAYTGDISGVMLAKLGCSYVTVGHSERRDYHGEDDATVNKKVKA
ALKHGITPIFCLGEKVDVREKGEHVAFCTDQLVAGLKGLTAEQVRGVVIAYEPVWAIGTG
KVASAADAQEVCSALRVKLAEAYGEDVASEVRVLYGGSVKSGSVGELIAQKDVDGALVGG
ASLDGDEFSKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgcactccgctgatcgcgggcaactggaagatgaatctgaaccacctggaggcc
atcgccctggtgcagaagatcgccttcgcgctgcccgagaagtactacgccaaggtcgag
gtggcggtgctcccgccgttcaccgacatccgcagcgtgcagaccctcgtcgacggcgac
aagctcctgctcaagtacggcgcgcaggacctgtccccgcacgactcgggcgcctacacc
ggcgacatctcgggcgtgatgctcgcgaagctcggctgctcctacgtcaccgtgggccac
tccgagcggcgcgactaccacggcgaggacgacgcgaccgtcaacaagaaggtcaaggcc
gccctcaagcacgggatcaccccgatcttctgcctcggcgagaaggtcgacgtgcgggag
aagggcgagcacgtcgccttctgcaccgaccagctcgtcgccggcctcaagggcctgacc
gccgagcaggtgcgcggcgtcgtcatcgcctacgagcccgtgtgggccatcggcaccggc
aaggtcgccagcgcggccgacgcgcaggaggtctgctcggcgctgcgggtcaagctggcc
gaggcgtacggcgaggacgtcgcgtccgaggtccgggtgctctacggcggctcggtgaag
tccggcagcgtcggcgagctgatcgcgcagaaggacgtcgacggcgccctcgtgggcggc
gcgagcctggacggcgacgagttcagcaagctctgcgcgctcgccgcgggtggtccccta
ccctga

DBGET integrated database retrieval system