KEGG   Actinosynnema mirum: Amir_5238Help
Entry
Amir_5238         CDS       T00957                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ami  Actinosynnema mirum
Pathway
ami00230  Purine metabolism
ami01100  Metabolic pathways
Module
ami_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Amir_5238
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Amir_5238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase MMR_HSR1 AAA_22 AAA_18 AAA_29 AAA_25 AAA_30 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ACU39059
JGI: Amir_5238
UniProt: C6W8Y7
Position
complement(6234290..6234889)
Genome map
AA seq 199 aa AA seqDB search
MSDGTGAGSGVRARPRLTVLSGPSGVGKSSVLAELRGRDPELHYSVSVTTRKPRPGELDG
VHYHFVDGAEFDRMVDAGELLEHAEFAGNRYGTPRAPVEAALASGLPSLLEIELQGARQV
RAAMPEARLVMLAPPSWEDLVARLTGRGTEDPAVVERRLAIARQELAAEPEFDEVVVNDD
VRSAATKLLDLVVGPLPGA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacggcaccggggcggggtcgggcgttcgcgcccggccccgcctcaccgttctg
tcgggtccctccggcgtcggcaagtccagcgtgctggccgagctgcgcggcagggacccc
gagctgcactacagcgtctcggtgaccaccaggaagccgaggccgggcgagctggacggc
gtccactaccacttcgtggacggcgccgagttcgaccgcatggtcgacgcgggcgagctg
ctggagcacgccgagttcgcgggcaaccgctacggcacccccagggcgcccgtggaggcc
gcgctggcgtcgggcctgccctccctgctggagatcgagctgcagggcgcgcggcaggtc
agggccgccatgcccgaggcgcggctggtcatgctggccccgccctcctgggaggacctc
gtcgcccggctcaccggccgcggcaccgaggaccccgccgtcgtcgagcgcaggctcgcg
atcgccaggcaggagctggcggccgaacccgagttcgacgaggtcgtcgtcaacgacgac
gtgcgttcggcggcgacgaagttgctagacttggtggtcggcccgctgcccggcgcctga

DBGET integrated database retrieval system