KEGG   Actinosynnema mirum: Amir_5669Help
Entry
Amir_5669         CDS       T00957                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ami  Actinosynnema mirum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Amir_5669
   01212 Fatty acid metabolism
    Amir_5669
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Amir_5669
   00650 Butanoate metabolism
    Amir_5669
  Lipid metabolism
   00071 Fatty acid degradation
    Amir_5669
   01040 Biosynthesis of unsaturated fatty acids
    Amir_5669
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Amir_5669
   00310 Lysine degradation
    Amir_5669
   00380 Tryptophan metabolism
    Amir_5669
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Amir_5669
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Amir_5669
   00281 Geraniol degradation
    Amir_5669
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Amir_5669
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Amir_5669
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Amir_5669
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Amir_5669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6681818..6683872
Genome map
AA seq 684 aa AA seqDB search
MAIRYERDAEGVVTLTMDMSGSANVMNAEYQEAMGAVVDRLEAERDEIAGVVLTSAKKTF
FAGGDLNLLVSVTPENSAEVLAGVSDVKAQLRRLEKLGRPVVAAIAGAALGGGLEIALAC
HHRVVLDDDRIKLGLPEVTLGLLPGGGGVTRMVRMLGLQAALPLLMEGKQLRPKRALEAG
FVDELASSKEDLLAKARAWIAANPEPVQPWDRKGHAVPGFRAFDPQSYGVLAAAPAVLHK
RTRGAFPAPEKILAAAVEGALVDFDTALVVEDRYFLELVSGQVAKNMIGTFWFQLGEIAA
GGSRPSGVERTSVARVGVLGAGMMGAGIAEVTARAGIPVVLKDVTLEAARRGAGENPGIT
PTDSDADLAGCDLVIEAVFEDRELKNRVLADAGSAALDGAVIASNTSTLPITGLAGAVAD
PERFIGLHFFSPVPKMRLVEIIRGERTSDETLARAFDYVLKIGKTPIVVNDSRGFYTSRT
FGAYVTEAIAMVGEGVAPALVENVAKRAGMAVGPLAVSDEVTLTLQLRIRDQAVADGGTG
AGGAGVRVVEELVAEGRTGKSGGAGFYEYPEGGRKFLWPGLARYGRADAGVTERDVEDRL
LFAQTLESVRCLDEGVLTSVRDANVGSVLGFGFAPWSGGTLQFANAYGLAAFVERADYLA
DTYGERFRPPSSLRERAKSGEDYR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggccatccgctacgagcgggacgccgagggcgtcgtcacgctgaccatggacatgtcg
ggctcggccaacgtgatgaacgccgagtaccaggaggcgatgggcgcggtcgtcgaccgg
ctggaggccgagcgcgacgagatcgcgggtgtggtgctgacctcggcgaagaagacgttc
ttcgcgggcggcgacctgaacctgctggtgtcggtgacgccggagaactccgccgaggtg
ctggcgggcgtgtcggacgtgaaggcgcagctgcgcaggctggagaagctcggcaggccg
gtggtggccgcgatcgcgggcgcggcgctcggcggcgggctggagatcgcgctggcctgc
caccaccgggtggtgctggacgacgaccggatcaagctggggctgcccgaggtgacgctg
gggctgctgcccggcggcggcggggtcaccaggatggtgcggatgctgggtctccaggcc
gcgctgccgctgctgatggagggcaagcagctgcgcccgaagcgcgcgctggaggccggg
ttcgtcgacgagctggcctcctcgaaggaagacctcctcgccaaggcgcgggcctggatc
gcggccaacccggagccggtgcagccgtgggaccgcaaggggcacgccgttcccggcttc
cgggcgttcgacccgcagtcgtacggggtgctcgcggcggcgcccgccgtgctgcacaag
aggacgcggggcgcgttccccgcgccggagaagatcctggcggcggccgtggagggcgcg
ctggtcgacttcgacaccgcgctcgtggtggaggaccggtacttcctggagctggtgtcc
gggcaggtcgccaagaacatgatcggcacgttctggttccagctgggcgagatcgccgcg
ggcgggtcgcgaccgtccggtgtggagcgcacctcggtggccagggtcggggtgctcggc
gcgggcatgatgggcgccgggatcgccgaggtgaccgcgagggcgggcatcccggtggtg
ctcaaggacgtgacgctggaggccgcgcggcgcggcgcgggcgagaaccccggcatcacg
cccaccgactcggacgccgacctcgccgggtgcgacctggtgatcgaggcggtgttcgag
gaccgggagctgaagaaccgggtgctcgcggacgccgggtcggccgcgctggacggcgcg
gtgatcgcgtccaacacctccacgctgccgatcaccgggctcgccggggcggtggcggac
ccggagcggttcatcgggctgcacttcttctcgccggtgccgaagatgcgcctggtggag
atcatccggggcgagcggacctcggacgagacgctggcccgcgcgttcgactacgtgctg
aagatcggcaagacgccgatcgtggtcaacgacagccggggcttctacacctcgcgcacg
ttcggcgcgtacgtcaccgaggccatcgcgatggtcggcgagggcgtggcccccgcgctg
gtggagaacgtcgccaagcgcgccgggatggccgtggggccgctcgcggtgtccgacgag
gtgacgctgacgctccagctgcgcatccgcgaccaggccgtggccgacggcgggaccggg
gcgggcggcgcgggcgtgcgggtggtggaggagctggtcgccgaggggcggaccggcaag
tccggcggggccgggttctacgagtaccccgagggcgggcggaagttcctgtggccgggg
ctggcccggtacgggcgcgcggacgccggggtcaccgagcgggacgtcgaggaccggctg
ctgttcgcgcagaccctggagtcggtgcggtgcctggacgagggggtgctcacgtcggtg
cgcgacgccaacgtgggcagcgtcctcgggttcgggttcgcgccgtggagcggcgggacg
ctccagttcgccaacgcctacgggctggcggcgttcgtggagcgcgccgactacctcgcg
gacacctacggcgagcggttccggccgccgtcgtcgctgcgcgagcgggccaagtcgggc
gaggactaccggtag

DBGET integrated database retrieval system