KEGG   Actinosynnema mirum: Amir_5669Help
Entry
Amir_5669         CDS       T00957                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ami  Actinosynnema mirum
Pathway
ami00071  Fatty acid degradation
ami00280  Valine, leucine and isoleucine degradation
ami00281  Geraniol degradation
ami00310  Lysine degradation
ami00362  Benzoate degradation
ami00380  Tryptophan metabolism
ami00410  beta-Alanine metabolism
ami00640  Propanoate metabolism
ami00650  Butanoate metabolism
ami00903  Limonene and pinene degradation
ami00930  Caprolactam degradation
ami01040  Biosynthesis of unsaturated fatty acids
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
ami01212  Fatty acid metabolism
Module
ami_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Amir_5669
   00650 Butanoate metabolism
    Amir_5669
  Lipid metabolism
   00071 Fatty acid degradation
    Amir_5669
   01040 Biosynthesis of unsaturated fatty acids
    Amir_5669
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Amir_5669
   00310 Lysine degradation
    Amir_5669
   00380 Tryptophan metabolism
    Amir_5669
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Amir_5669
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Amir_5669
   00281 Geraniol degradation
    Amir_5669
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Amir_5669
   00930 Caprolactam degradation
    Amir_5669
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Amir_5669
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Amir_5669
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Amir_5669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DUF1731 2-Hacid_dh_C Rossmann-like
Motif
Other DBs
NCBI-ProteinID: ACU39484
JGI: Amir_5669
UniProt: C6WC96
Position
6681818..6683872
Genome map
AA seq 684 aa AA seqDB search
MAIRYERDAEGVVTLTMDMSGSANVMNAEYQEAMGAVVDRLEAERDEIAGVVLTSAKKTF
FAGGDLNLLVSVTPENSAEVLAGVSDVKAQLRRLEKLGRPVVAAIAGAALGGGLEIALAC
HHRVVLDDDRIKLGLPEVTLGLLPGGGGVTRMVRMLGLQAALPLLMEGKQLRPKRALEAG
FVDELASSKEDLLAKARAWIAANPEPVQPWDRKGHAVPGFRAFDPQSYGVLAAAPAVLHK
RTRGAFPAPEKILAAAVEGALVDFDTALVVEDRYFLELVSGQVAKNMIGTFWFQLGEIAA
GGSRPSGVERTSVARVGVLGAGMMGAGIAEVTARAGIPVVLKDVTLEAARRGAGENPGIT
PTDSDADLAGCDLVIEAVFEDRELKNRVLADAGSAALDGAVIASNTSTLPITGLAGAVAD
PERFIGLHFFSPVPKMRLVEIIRGERTSDETLARAFDYVLKIGKTPIVVNDSRGFYTSRT
FGAYVTEAIAMVGEGVAPALVENVAKRAGMAVGPLAVSDEVTLTLQLRIRDQAVADGGTG
AGGAGVRVVEELVAEGRTGKSGGAGFYEYPEGGRKFLWPGLARYGRADAGVTERDVEDRL
LFAQTLESVRCLDEGVLTSVRDANVGSVLGFGFAPWSGGTLQFANAYGLAAFVERADYLA
DTYGERFRPPSSLRERAKSGEDYR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggccatccgctacgagcgggacgccgagggcgtcgtcacgctgaccatggacatgtcg
ggctcggccaacgtgatgaacgccgagtaccaggaggcgatgggcgcggtcgtcgaccgg
ctggaggccgagcgcgacgagatcgcgggtgtggtgctgacctcggcgaagaagacgttc
ttcgcgggcggcgacctgaacctgctggtgtcggtgacgccggagaactccgccgaggtg
ctggcgggcgtgtcggacgtgaaggcgcagctgcgcaggctggagaagctcggcaggccg
gtggtggccgcgatcgcgggcgcggcgctcggcggcgggctggagatcgcgctggcctgc
caccaccgggtggtgctggacgacgaccggatcaagctggggctgcccgaggtgacgctg
gggctgctgcccggcggcggcggggtcaccaggatggtgcggatgctgggtctccaggcc
gcgctgccgctgctgatggagggcaagcagctgcgcccgaagcgcgcgctggaggccggg
ttcgtcgacgagctggcctcctcgaaggaagacctcctcgccaaggcgcgggcctggatc
gcggccaacccggagccggtgcagccgtgggaccgcaaggggcacgccgttcccggcttc
cgggcgttcgacccgcagtcgtacggggtgctcgcggcggcgcccgccgtgctgcacaag
aggacgcggggcgcgttccccgcgccggagaagatcctggcggcggccgtggagggcgcg
ctggtcgacttcgacaccgcgctcgtggtggaggaccggtacttcctggagctggtgtcc
gggcaggtcgccaagaacatgatcggcacgttctggttccagctgggcgagatcgccgcg
ggcgggtcgcgaccgtccggtgtggagcgcacctcggtggccagggtcggggtgctcggc
gcgggcatgatgggcgccgggatcgccgaggtgaccgcgagggcgggcatcccggtggtg
ctcaaggacgtgacgctggaggccgcgcggcgcggcgcgggcgagaaccccggcatcacg
cccaccgactcggacgccgacctcgccgggtgcgacctggtgatcgaggcggtgttcgag
gaccgggagctgaagaaccgggtgctcgcggacgccgggtcggccgcgctggacggcgcg
gtgatcgcgtccaacacctccacgctgccgatcaccgggctcgccggggcggtggcggac
ccggagcggttcatcgggctgcacttcttctcgccggtgccgaagatgcgcctggtggag
atcatccggggcgagcggacctcggacgagacgctggcccgcgcgttcgactacgtgctg
aagatcggcaagacgccgatcgtggtcaacgacagccggggcttctacacctcgcgcacg
ttcggcgcgtacgtcaccgaggccatcgcgatggtcggcgagggcgtggcccccgcgctg
gtggagaacgtcgccaagcgcgccgggatggccgtggggccgctcgcggtgtccgacgag
gtgacgctgacgctccagctgcgcatccgcgaccaggccgtggccgacggcgggaccggg
gcgggcggcgcgggcgtgcgggtggtggaggagctggtcgccgaggggcggaccggcaag
tccggcggggccgggttctacgagtaccccgagggcgggcggaagttcctgtggccgggg
ctggcccggtacgggcgcgcggacgccggggtcaccgagcgggacgtcgaggaccggctg
ctgttcgcgcagaccctggagtcggtgcggtgcctggacgagggggtgctcacgtcggtg
cgcgacgccaacgtgggcagcgtcctcgggttcgggttcgcgccgtggagcggcgggacg
ctccagttcgccaacgcctacgggctggcggcgttcgtggagcgcgccgactacctcgcg
gacacctacggcgagcggttccggccgccgtcgtcgctgcgcgagcgggccaagtcgggc
gaggactaccggtag

DBGET integrated database retrieval system