KEGG   Actinosynnema mirum: Amir_5700Help
Entry
Amir_5700         CDS       T00957                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ami  Actinosynnema mirum
Pathway
ami00260  Glycine, serine and threonine metabolism
ami00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01130  Biosynthesis of antibiotics
ami01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amir_5700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amir_5700
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amir_5700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB ALF KDGP_aldolase
Motif
Other DBs
NCBI-ProteinID: ACU39515
JGI: Amir_5700
UniProt: C6WCC7
Position
complement(6730301..6731086)
Genome map
AA seq 261 aa AA seqDB search
MSALDGVFSTCRDEGRSALIGYLPAGFPTVEGSKDVLRAMVESGCDVVEVGMPYSDPVMD
GPTIQAAAQQALDGGFRVRDLFGVVESVAALGGKAVVMTYWNPVLHYGVDAFSRDLAAAG
GLGLITPDLVPDEAEDWMAASEAHGLDRIFLVAPSSTEERIDLTAKASSGFLYATAVMGV
TGARTAVSSAAPALVGRVREHTDMPVCVGLGVRDGAQAAQVASFADGVIVGSAFVSAVAG
GGVPALAEELAKGVRGVGGPA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgttggacggcgttttctcgacgtgccgggacgaggggcgctccgcgctcatc
ggctacctgcccgccgggttccccacggtcgagggctccaaggacgtcctgcgggccatg
gtcgagtccgggtgcgacgtggtcgaggtcgggatgccctactccgacccggtgatggac
ggcccgaccatccaggccgccgcgcagcaggcgctcgacggcgggttccgggtgcgggac
ctgttcggcgtggtcgagtcggtcgccgcgctcggcggcaaggccgtggtgatgacctac
tggaacccggtgctgcactacggcgtggacgcgttctcccgcgacctcgccgccgcgggc
ggcctcgggctgatcaccccggacctggtgcccgacgaggccgaggactggatggcggcc
tccgaggcgcacgggctcgaccggatcttcctggtcgcgccctcctccaccgaggagcgg
atcgacctgaccgccaaggcctccagcggcttcctgtacgccaccgccgtcatgggcgtg
accggcgcgcggacggccgtgtcgtcggcggcccccgcgctggtcgggcgggtcagggag
cacaccgacatgccggtgtgcgtcggcctcggcgtgcgggacggcgcgcaggccgcgcag
gtcgcctcgttcgcggacggggtgatcgtcggctcggcgttcgtgtcggcggtggccggt
ggcggggtgcccgcgctggccgaggagctggcgaagggcgtgcgcggggtcggcggcccg
gcctga

DBGET integrated database retrieval system