KEGG   Actinosynnema mirum: Amir_5700Help
Entry
Amir_5700         CDS       T00957                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ami  Actinosynnema mirum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ami00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Amir_5700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Amir_5700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Amir_5700
Enzymes [BR:ami01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Amir_5700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(6730301..6731086)
Genome map
AA seq 261 aa AA seqDB search
MSALDGVFSTCRDEGRSALIGYLPAGFPTVEGSKDVLRAMVESGCDVVEVGMPYSDPVMD
GPTIQAAAQQALDGGFRVRDLFGVVESVAALGGKAVVMTYWNPVLHYGVDAFSRDLAAAG
GLGLITPDLVPDEAEDWMAASEAHGLDRIFLVAPSSTEERIDLTAKASSGFLYATAVMGV
TGARTAVSSAAPALVGRVREHTDMPVCVGLGVRDGAQAAQVASFADGVIVGSAFVSAVAG
GGVPALAEELAKGVRGVGGPA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgttggacggcgttttctcgacgtgccgggacgaggggcgctccgcgctcatc
ggctacctgcccgccgggttccccacggtcgagggctccaaggacgtcctgcgggccatg
gtcgagtccgggtgcgacgtggtcgaggtcgggatgccctactccgacccggtgatggac
ggcccgaccatccaggccgccgcgcagcaggcgctcgacggcgggttccgggtgcgggac
ctgttcggcgtggtcgagtcggtcgccgcgctcggcggcaaggccgtggtgatgacctac
tggaacccggtgctgcactacggcgtggacgcgttctcccgcgacctcgccgccgcgggc
ggcctcgggctgatcaccccggacctggtgcccgacgaggccgaggactggatggcggcc
tccgaggcgcacgggctcgaccggatcttcctggtcgcgccctcctccaccgaggagcgg
atcgacctgaccgccaaggcctccagcggcttcctgtacgccaccgccgtcatgggcgtg
accggcgcgcggacggccgtgtcgtcggcggcccccgcgctggtcgggcgggtcagggag
cacaccgacatgccggtgtgcgtcggcctcggcgtgcgggacggcgcgcaggccgcgcag
gtcgcctcgttcgcggacggggtgatcgtcggctcggcgttcgtgtcggcggtggccggt
ggcggggtgcccgcgctggccgaggagctggcgaagggcgtgcgcggggtcggcggcccg
gcctga

DBGET integrated database retrieval system