KEGG   Actinosynnema mirum: Amir_5700Help
Entry
Amir_5700         CDS       T00957                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ami  Actinosynnema mirum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ami01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ami00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ami00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6730301..6731086)
Genome map
AA seq 261 aa AA seqDB search
MSALDGVFSTCRDEGRSALIGYLPAGFPTVEGSKDVLRAMVESGCDVVEVGMPYSDPVMD
GPTIQAAAQQALDGGFRVRDLFGVVESVAALGGKAVVMTYWNPVLHYGVDAFSRDLAAAG
GLGLITPDLVPDEAEDWMAASEAHGLDRIFLVAPSSTEERIDLTAKASSGFLYATAVMGV
TGARTAVSSAAPALVGRVREHTDMPVCVGLGVRDGAQAAQVASFADGVIVGSAFVSAVAG
GGVPALAEELAKGVRGVGGPA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgttggacggcgttttctcgacgtgccgggacgaggggcgctccgcgctcatc
ggctacctgcccgccgggttccccacggtcgagggctccaaggacgtcctgcgggccatg
gtcgagtccgggtgcgacgtggtcgaggtcgggatgccctactccgacccggtgatggac
ggcccgaccatccaggccgccgcgcagcaggcgctcgacggcgggttccgggtgcgggac
ctgttcggcgtggtcgagtcggtcgccgcgctcggcggcaaggccgtggtgatgacctac
tggaacccggtgctgcactacggcgtggacgcgttctcccgcgacctcgccgccgcgggc
ggcctcgggctgatcaccccggacctggtgcccgacgaggccgaggactggatggcggcc
tccgaggcgcacgggctcgaccggatcttcctggtcgcgccctcctccaccgaggagcgg
atcgacctgaccgccaaggcctccagcggcttcctgtacgccaccgccgtcatgggcgtg
accggcgcgcggacggccgtgtcgtcggcggcccccgcgctggtcgggcgggtcagggag
cacaccgacatgccggtgtgcgtcggcctcggcgtgcgggacggcgcgcaggccgcgcag
gtcgcctcgttcgcggacggggtgatcgtcggctcggcgttcgtgtcggcggtggccggt
ggcggggtgcccgcgctggccgaggagctggcgaagggcgtgcgcggggtcggcggcccg
gcctga

DBGET integrated database retrieval system